Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50220502
Substrate/Competitorn/a
Meas. Tech.ChEMBL_3681
IC50<50±n/a nM
Citation Isaac, MBXin, TO'Brien, ASt-Martin, DNaismith, AMacLean, NWilson, JDemchyshyn, LTehim, ASlassi, A 1-(Bicyclopiperazinyl)ethylindoles and 1-(homopiperazinyl)ethyl-indoles as highly selective and potent 5-HT(7) receptor ligands. Bioorg Med Chem Lett12:2451-4 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin (5-HT) receptor
Synonyms:5-HT-7 | 5-HT-X | 5-HT7 | 5-HT7L | 5-HT7S | 5-HT7b | 5-hydroxytryptamine receptor 7 | 5HT7 | HTR7
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:53573.08
Organism:Homo sapiens (Human)
Description:P34969
Residue:479
Sequence:
MMDVNSSGRPDLYGHLRSFLLPEVGRGLPDLSPDGGADPVAGSWAPHLLSEVTASPAPTW
DAPPDNASGCGEQINYGRVEKVVIGSILTLITLLTIAGNCLVVISVCFVKKLRQPSNYLI
VSLALADLSVAVAVMPFVSVTDLIGGKWIFGHFFCNVFIAMDVMCCTASIMTLCVISIDR
YLGITRPLTYPVRQNGKCMAKMILSVWLLSASITLPPLFGWAQNVNDDKVCLISQDFGYT
IYSTAVAFYIPMSVMLFMYYQIYKAARKSAAKHKFPGFPRVEPDSVIALNGIVKLQKEVE
ECANLSRLLKHERKNISIFKREQKAATTLGIIVGAFTVCWLPFFLLSTARPFICGTSCSC
IPLWVERTFLWLGYANSLINPFIYAFFNRDLRTTYRSLLQCQYRNINRKLSAAGMHEALK
LAERPERPEFVLRACTRRVLLRPEKRPPVSVWVLQSPDHHNWLADKMLTTVEKKVMIHD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50220502
NameBDBM50220502
Synonyms:CHEMBL419646
TypeSmall organic molecule
Emp. Form.C21H23FN6
Mol. Mass.378.4459
SMILESC[C@H](Nc1nc(N)nc(NC[C@H]2C[C@@H]2c2ccc(F)cc2)n1)c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a