Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50118197
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155144
Ki 12600±n/a nM
Citation Strømgaard, KSaito, DRShindou, HIshii, SShimizu, TNakanishi, K Ginkgolide derivatives for photolabeling studies: preparation and pharmacological evaluation. J Med Chem45:4038-46 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:PROTEIN
Mol. Mass.:39163.36
Organism:Mus musculus
Description:ChEMBL_155144
Residue:341
Sequence:
MEHNGSFRVDSEFRYTLFPIVYSVIFILGVVANGYVLWVFANLYPSKKLNEIKIFMVNLT
MADLLFLITLPLWIVYYYNEGDWILPNFLCNVAGCLFFINTYCSVAFLGVITYNRYQAVA
YPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPY
SVPILVVHVFIAFCFFLVFFLIFYCNLVIIHTLLTQPMRQQRKAGVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR
KHLSEKFYSMRSSRKCSRATSDTCTEVIVPANQTPIVSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118197
NameBDBM50118197
Synonyms:3'-(tert-butyl)-4,4',9',14'-tetrahydroxy-2-methoxy-10'-methylspiro[tetrahydrofuran-3,2'-(6',12'-dioxatetracyclo[6.6.0.01,5.09,13]tetradecane)]-5,7',11'-trione | CHEMBL441286
TypeSmall organic molecule
Emp. Form.C21H28O11
Mol. Mass.456.4404
SMILESCOC1OC(=O)[C@H](O)C11[C@@H]([C@@H](O)C2OC(=O)C3[C@@]4(O)[C@H](C)C(=O)O[C@H]4[C@H](O)[C@]123)C(C)(C)C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a