Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50118200
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155144
Ki 790.0±n/a nM
Citation Strømgaard, KSaito, DRShindou, HIshii, SShimizu, TNakanishi, K Ginkgolide derivatives for photolabeling studies: preparation and pharmacological evaluation. J Med Chem45:4038-46 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:PROTEIN
Mol. Mass.:39163.36
Organism:Mus musculus
Description:ChEMBL_155144
Residue:341
Sequence:
MEHNGSFRVDSEFRYTLFPIVYSVIFILGVVANGYVLWVFANLYPSKKLNEIKIFMVNLT
MADLLFLITLPLWIVYYYNEGDWILPNFLCNVAGCLFFINTYCSVAFLGVITYNRYQAVA
YPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPY
SVPILVVHVFIAFCFFLVFFLIFYCNLVIIHTLLTQPMRQQRKAGVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR
KHLSEKFYSMRSSRKCSRATSDTCTEVIVPANQTPIVSLKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50118200
NameBDBM50118200
Synonyms:6-(4-azido-2,3,5,6-tetrafluorobenzyloxy)-8-(tert-butyl)-9,12,17-trihydroxy-16-methyl-2,4,14,19-tetraoxahexacyclo[8.7.2.01,11.03,7.07,11.013,17]nonadecane-5,15,18-trione | CHEMBL131402
TypeSmall organic molecule
Emp. Form.C27H25F4N3O11
Mol. Mass.643.4945
SMILESC[C@@H]1C(=O)O[C@H]2[C@H](O)[C@]34C5OC(=O)C3(OC3OC(=O)[C@H](OCc6c(F)c(F)c(N=[N+]=[N-])c(F)c6F)C43[C@@H]([C@H]5O)C(C)(C)C)[C@@]12O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a