Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGRIA1
LigandBDBM50122084
Substrate/Competitorn/a
Meas. Tech.ChEMBL_72845
Ki 64±n/a nM
Citation Kromann, HKrikstolaityte, SAndersen, AJAndersen, KKrogsgaard-Larsen, PJaroszewski, JWEgebjerg, JStrømgaard, K Solid-phase synthesis of polyamine toxin analogues: potent and selective antagonists of Ca2+-permeable AMPA receptors. J Med Chem45:5745-54 (2002) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
GRIA1
Name:Glutamate receptor AMPA 1/2
Synonyms:AMPA-selective glutamate receptor 1 | GluR-1 | GluR-A | GluR-K1 | Glutamate AMPA 1 | Glutamate receptor 1 | Glutamate receptor ionotropic AMPA | Glutamate receptor ionotropic, AMPA 1
Type:Enzyme Catalytic Domain
Mol. Mass.:101512.92
Organism:Homo sapiens (Human)
Description:Glutamate AMPA 1 GRIA1 HUMAN::P42261
Residue:906
Sequence:
MQHIFAFFCTGFLGAVVGANFPNNIQIGGLFPNQQSQEHAAFRFALSQLTEPPKLLPQID
IVNISDSFEMTYRFCSQFSKGVYAIFGFYERRTVNMLTSFCGALHVCFITPSFPVDTSNQ
FVLQLRPELQDALISIIDHYKWQKFVYIYDADRGLSVLQKVLDTAAEKNWQVTAVNILTT
TEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQIIKLEKNGIGYHYILANLGFMDIDL
NKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDARDHTRVDWKRPKYTSALTYDGVKVM
AEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGIDIQRALQQVRFEGLTGNVQFNEKGR
RTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQNRTYIVTTILEDPYV
MLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGE
LVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIW
MCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQ
QGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIA
YGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMIRVRKSKGKYAYLLES
TMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRNPVNLAVLKLNEQGLLDKLKNKW
WYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYKSRSESKRMK
GFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGENGRVVSHDFPKSMQSIPCMSHSSGMP
LGATGL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50122084
NameBDBM50122084
Synonyms:CHEMBL153996 | N-[1-[8-(3-Amino-propylamino)-octylcarbamoyl]-2-(4-hydroxy-phenyl)-ethyl]-isonicotinamide
TypeSmall organic molecule
Emp. Form.C26H39N5O3
Mol. Mass.469.6196
SMILESNCCCNCCCCCCCCNC(=O)C(Cc1ccc(O)cc1)NC(=O)c1ccncc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a