Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50123644
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155145
Ki 120±n/a nM
Citation Vogensen, SBStrømgaard, KShindou, HJaracz, SSuehiro, MIshii, SShimizu, TNakanishi, K Preparation of 7-substituted ginkgolide derivatives: potent platelet activating factor (PAF) receptor antagonists. J Med Chem46:601-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50123644
NameBDBM50123644
Synonyms:6-benzyloxy-8-(tert-butyl)-12,17-dihydroxy-16-methyl-(6R,8R,12R,16S,17R)-2,4,14,19-tetraoxahexacyclo[8.7.2.01,11.03,7.07,11.013,17]nonadecane-5,15,18-trione | CHEMBL345420
TypeSmall organic molecule
Emp. Form.C27H30O10
Mol. Mass.514.5211
SMILESC[C@@H]1C(=O)OC2[C@H](O)C34C5CC(C(C)(C)C)C33C(OC(=O)[C@@H]3OCc3ccccc3)OC4(C(=O)O5)[C@@]12O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a