Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlatelet activating factor receptor
LigandBDBM50123645
Substrate/Competitorn/a
Meas. Tech.ChEMBL_155145
Ki 2400±n/a nM
Citation Vogensen, SBStrømgaard, KShindou, HJaracz, SSuehiro, MIshii, SShimizu, TNakanishi, K Preparation of 7-substituted ginkgolide derivatives: potent platelet activating factor (PAF) receptor antagonists. J Med Chem46:601-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Platelet activating factor receptor
Name:Platelet activating factor receptor
Synonyms:PAF-R | Platelet-activating factor receptor
Type:Protein
Mol. Mass.:39005.63
Organism:Cavia porcellus
Description:n/a
Residue:342
Sequence:
MELNSSSRVDSEFRYTLFPIVYSIIFVLGIIANGYVLWVFARLYPSKKLNEIKIFMVNLT
VADLLFLITLPLWIVYYSNQGNWFLPKFLCNLAGCLFFINTYCSVAFLGVITYNRFQAVK
YPIKTAQATTRKRGIALSLVIWVAIVAAASYFLVMDSTNVVSNKAGSGNITRCFEHYEKG
SKPVLIIHICIVLGFFIVFLLILFCNLVIIHTLLRQPVKQQRNAEVRRRALWMVCTVLAV
FVICFVPHHMVQLPWTLAELGMWPSSNHQAINDAHQVTLCLLSTNCVLDPVIYCFLTKKF
RKHLSEKLNIMRSSQKCSRVTTDTGTEMAIPINHTPVNPIKN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50123645
NameBDBM50123645
Synonyms:CHEMBL348623 | benzyl (6R,9R,12R,16S,17R)-8-tert-butyl-6,12,17-trihydroxy-16-methyl-5,15,18-trioxo-2,4,14,19-tetraoxahexacyclo[8.7.2.0^{1,11}.0^{3,7}.0^{7,11}.0^{13,17}]nonadecan-9-yl carbonate
TypeSmall organic molecule
Emp. Form.C28H30O13
Mol. Mass.574.53
SMILESC[C@@H]1C(=O)OC2[C@H](O)C34C5OC(=O)C3(OC3OC(=O)[C@H](O)C43C([C@H]5OC(=O)OCc3ccccc3)C(C)(C)C)[C@@]12O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a