Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHuman immunodeficiency virus type 1 protease
LigandBDBM50124716
Substrate/Competitorn/a
Meas. Tech.ChEBML_157538
Ki 0.037000±n/a nM
Citation Kaltenbach, RFPatel, MWaltermire, REHarris, GDStone, BRKlabe, RMGarber, SBacheler, LTCordova, BCLogue, KWright, MRErickson-Viitanen, STrainor, GL Synthesis, antiviral activity and pharmacokinetics of P1/P1' substituted 3-aminoindazole cyclic urea HIV protease inhibitors. Bioorg Med Chem Lett13:605-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Human immunodeficiency virus type 1 protease
Name:Human immunodeficiency virus type 1 protease
Synonyms:Pol polyprotein
Type:Enzyme Subunit
Mol. Mass.:10781.16
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:99
Sequence:
PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50124716
NameBDBM50124716
Synonyms:(4R,5S,6S,7R)-1-(3-Amino-1H-indazol-5-ylmethyl)-3-butyl-5,6-dihydroxy-4,7-bis-(4-methyl-benzyl)-[1,3]diazepan-2-one | CHEMBL154962
TypeSmall organic molecule
Emp. Form.C33H41N5O3
Mol. Mass.555.7103
SMILESCCCCN1[C@H](Cc2ccc(C)cc2)[C@H](O)[C@@H](O)[C@@H](Cc2ccc(C)cc2)N(Cc2ccc3[nH]nc(N)c3c2)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a