Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPA/PB1
LigandBDBM50409793
Substrate/Competitorn/a
Meas. Tech.ChEMBL_64976
IC50 17000±n/a nM
Citation Parkes, KEErmert, PFässler, JIves, JMartin, JAMerrett, JHObrecht, DWilliams, GKlumpp, K Use of a pharmacophore model to discover a new class of influenza endonuclease inhibitors. J Med Chem46:1153-64 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
PA/PB1
Name:PA/PB1
Synonyms:Hepatitis C virus polyprotein | Polymerase acidic protein | RNA-directed RNA polymerase subunit P2
Type:PROTEIN
Mol. Mass.:82573.84
Organism:Hepatitis C virus
Description:ChEMBL_64976
Residue:716
Sequence:
MEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDFHFINEQGES
IIVELGDPNALLKHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEI
GVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRLFTIRQ
EMASRGLWDSFRQSERGEETIEERFEITGTMRKLADQSLPPNFSSLENFRAYVDGFEPNG
YIEGKLSQMSKEVNARIEPFLKTTPRPLRLPNGPPCSQRSKFLLMDALKLSIEDPSHEGE
GIPLYDAIKCMRTFFGWKEPNVVKPHEKGINPNYLLSWKQVLAELQDIENEEKIPKTKNM
KKTSQLKWALGENMAPEKVDFDDCKDVGDLKQYDSDEPELRSLASWIQNEFNKACELTDS
SWIELDEIGEDVAPIEHIASMRRNYFTSEVSHCRATEYIMKGVYINTALLNASCAAMDDF
QLIPMISKCRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKY
CVLEIGDMLIRSAIGQVSRPMFLYVRTNGTSKIKMKWGMEMRRCLLQSLQQIESMIEAES
SVKEKDMTKEFFENKSETWPIGESPKGVEESSIGKVCRTLLAKSVFNSLYASPQLEGFSA
ESRKLLLIVQALRDNLEPGTFDLGGLYEAIEECLINDPWVLLNASWFNSFLTHALS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50409793
NameBDBM50409793
Synonyms:CHEMBL280446
TypeSmall organic molecule
Emp. Form.C24H16N4O4
Mol. Mass.424.4082
SMILESOc1c(C(=O)c2ccccc2)c2ccc(NC(=O)c3cnc4ccccc4n3)cc2n1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a