Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEcdysone receptor
LigandBDBM50128300
Substrate/Competitorn/a
Meas. Tech.ChEMBL_65456
EC50 1410±n/a nM
Citation Tice, CMHormann, REThompson, CSFriz, JLCavanaugh, CKSaggers, JA Optimization of alpha-acylaminoketone ecdysone agonists for control of gene expression. Bioorg Med Chem Lett13:1883-6 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Ecdysone receptor
Name:Ecdysone receptor
Synonyms:20-hydroxy-ecdysone receptor | 20E receptor | EcRH | Ecdysteroid receptor | Nuclear receptor subfamily 1 group H member 1
Type:PROTEIN
Mol. Mass.:68199.29
Organism:Bombyx mori
Description:ChEMBL_65456
Residue:606
Sequence:
MRVENVDNVSFALNGRADEWCMSVETRLDSLVREKSEVKAYVGGCPSVITDAGAYDALFD
MRRRWSNNGGFPLRMLEESSSEVTSSSALGLPPAMVMSPESLASPEYRALELWSYDDGIT
YNTAQSLLGACNMQQQQLQPQQPHPAPPTLPTMPLPMPPTTPKSENESMSSGREELSPAS
SINGCSADADARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAV
YICKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVIQEPSKNKDRQRQKKDKGILLPV
STTTVEDHMPPIMQCDPPPPEAARIHEVVPRYLSEKLMEQNRQKNIPPLSANQKSLIARL
VWYQEGYEQPSDEDLKRVTQTWQSDEEDEESDLPFRQITEMTILTVQLIVEFAKGLPGFS
KISQSDQITLLKASSSEVMMLRVARRYDAASDSVLFANNKAYTRDNYRQGGMAYVIEDLL
HFCRCMFAMGMDNVHFALLTAIVIFSDRPGLEQPSLVEEIQRYYLNTLRIYIINQNSASS
RCAVIYGRILSVLTELRTLGTQNSNMCISLKLKNRKLPPFLEEIWDVAEVATTHPTVLPP
TNPVVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50128300
NameBDBM50128300
Synonyms:CHEMBL55869 | N-[1-(3,5-Dimethyl-benzoyl)-cyclohexyl]-3-methoxy-2-methyl-benzamide
TypeSmall organic molecule
Emp. Form.C24H29NO3
Mol. Mass.379.492
SMILESCOc1cccc(C(=O)NC2(CCCCC2)C(=O)c2cc(C)cc(C)c2)c1C
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a