Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEcdysone receptor
LigandBDBM50128297
Substrate/Competitorn/a
Meas. Tech.ChEMBL_65456
EC50 740±n/a nM
Citation Tice, CMHormann, REThompson, CSFriz, JLCavanaugh, CKSaggers, JA Optimization of alpha-acylaminoketone ecdysone agonists for control of gene expression. Bioorg Med Chem Lett13:1883-6 (2003) [PubMed]
More Info.:Get all data from this article,  Assay Method
 
Ecdysone receptor
Name:Ecdysone receptor
Synonyms:20-hydroxy-ecdysone receptor | 20E receptor | EcRH | Ecdysteroid receptor | Nuclear receptor subfamily 1 group H member 1
Type:PROTEIN
Mol. Mass.:68199.29
Organism:Bombyx mori
Description:ChEMBL_65456
Residue:606
Sequence:
MRVENVDNVSFALNGRADEWCMSVETRLDSLVREKSEVKAYVGGCPSVITDAGAYDALFD
MRRRWSNNGGFPLRMLEESSSEVTSSSALGLPPAMVMSPESLASPEYRALELWSYDDGIT
YNTAQSLLGACNMQQQQLQPQQPHPAPPTLPTMPLPMPPTTPKSENESMSSGREELSPAS
SINGCSADADARRQKKGPAPRQQEELCLVCGDRASGYHYNALTCEGCKGFFRRSVTKNAV
YICKFGHACEMDMYMRRKCQECRLKKCLAVGMRPECVIQEPSKNKDRQRQKKDKGILLPV
STTTVEDHMPPIMQCDPPPPEAARIHEVVPRYLSEKLMEQNRQKNIPPLSANQKSLIARL
VWYQEGYEQPSDEDLKRVTQTWQSDEEDEESDLPFRQITEMTILTVQLIVEFAKGLPGFS
KISQSDQITLLKASSSEVMMLRVARRYDAASDSVLFANNKAYTRDNYRQGGMAYVIEDLL
HFCRCMFAMGMDNVHFALLTAIVIFSDRPGLEQPSLVEEIQRYYLNTLRIYIINQNSASS
RCAVIYGRILSVLTELRTLGTQNSNMCISLKLKNRKLPPFLEEIWDVAEVATTHPTVLPP
TNPVVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50128297
NameBDBM50128297
Synonyms:5-Ethyl-2,3-dihydro-benzo[1,4]dioxine-6-carboxylic acid [1-(3,5-dimethyl-benzoyl)-cyclohexyl]-amide | CHEMBL57730
TypeSmall organic molecule
Emp. Form.C26H31NO4
Mol. Mass.421.5286
SMILESCCc1c2OCCOc2ccc1C(=O)NC1(CCCCC1)C(=O)c1cc(C)cc(C)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a