Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCdc25C
LigandBDBM50129572
Substrate/Competitorn/a
Meas. Tech.ChEMBL_49190
IC50 15000±n/a nM
Citation Sohn, JKiburz, BLi, ZDeng, LSafi, APirrung, MCRudolph, J Inhibition of Cdc25 phosphatases by indolyldihydroxyquinones. J Med Chem46:2580-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Cdc25C
Name:Cdc25C
Synonyms:Dual specificity phosphatase Cdc25C | M-phase inducer phosphatase 3
Type:Substrate
Mol. Mass.:53366.11
Organism:Homo sapiens (Human)
Description:P30307
Residue:473
Sequence:
MSTELFSSTREEGSSGSGPSFRSNQRKMLNLLLERDTSFTVCPDVPRTPVGKFLGDSANL
SILSGGTPKRCLDLSNLSSGEITATQLTTSADLDETGHLDSSGLQEVHLAGMNHDQHLMK
CSPAQLLCSTPNGLDRGHRKRDAMCSSSANKENDNGNLVDSEMKYLGSPITTVPKLDKNP
NLGEDQAEEISDELMEFSLKDQEAKVSRSGLYRSPSMPENLNRPRLKQVEKFKDNTIPDK
VKKKYFSGQGKLRKGLCLKKTVSLCDITITQMLEEDSNQGHLIGDFSKVCALPTVSGKHQ
DLKYVNPETVAALLSGKFQGLIEKFYVIDCRYPYEYLGGHIQGALNLYSQEELFNFFLKK
PIVPLDTQKRIIIVFHCEFSSERGPRMCRCLREEDRSLNQYPALYYPELYILKGGYRDFF
PEYMELCEPQSYCPMHHQDHKTELLRCRSQSKVQEGERQLREQIALLVKDMSP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50129572
n/a
NameBDBM50129572
Synonyms:3-(1H-Benzo[g]indol-3-yl)-2,5-dihydroxy-[1,4]benzoquinone | CHEMBL88098
TypeSmall organic molecule
Emp. Form.C18H11NO4
Mol. Mass.305.2842
SMILESO=C1CC(=O)C(=O)C(c2c[nH]c3c2ccc2ccccc32)C1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: