Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProtein tyrosine phosphatase receptor type C-associated protein
LigandBDBM50131860
Substrate/Competitorn/a
Meas. Tech.ChEMBL_210866
Ki 42000000±n/a nM
Citation Swierczek, KPandey, ASPeters, JWHengge, AC A comparison of phosphonothioic acids with phosphonic acids as phosphatase inhibitors. J Med Chem46:3703-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Protein tyrosine phosphatase receptor type C-associated protein
Name:Protein tyrosine phosphatase receptor type C-associated protein
Synonyms:CD45-AP | CD45-associated protein | Lymphocyte phosphatase-associated phosphoprotein | PTPRC-associated protein
Type:PROTEIN
Mol. Mass.:21182.08
Organism:Homo sapiens (Human)
Description:ChEMBL_210870
Residue:206
Sequence:
MALPCTLGLGMLLALPGALGSGGSAEDSVGSSSVTVVLLLLLLLLLATGLALAWRRLSRD
SGGYYHPARLGAALWGRTRRLLWASPPGRWLQARAELGSTDNDLERQEDEQDTDYDHVAD
GGLQADPGEGEQQCGEASSPEQVPVRAEEARDSDTEGDLVLGSPGPASAGGSAEALLSDL
HAFAGSAAWDDSARAAGGQGLHVTAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131860
NameBDBM50131860
Synonyms:6-Phosphono-hexanoic acid | CHEMBL122539
TypeSmall organic molecule
Emp. Form.C6H13O5P
Mol. Mass.196.1382
SMILESOC(=O)CCCCCP(O)(O)=O
Structure
n/a