Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase placental-like
LigandBDBM50131864
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157081
Ki 1550000±n/a nM
Citation Swierczek, KPandey, ASPeters, JWHengge, AC A comparison of phosphonothioic acids with phosphonic acids as phosphatase inhibitors. J Med Chem46:3703-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alkaline phosphatase placental-like
Name:Alkaline phosphatase placental-like
Synonyms:placental-like alkaline phosphatase preproprotein
Type:PROTEIN
Mol. Mass.:57374.31
Organism:Homo sapiens (Human)
Description:ChEMBL_29964
Residue:532
Sequence:
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131864
NameBDBM50131864
Synonyms:CHEMBL125296 | Propyl-phosphonic acid
TypeSmall organic molecule
Emp. Form.C3H9O3P
Mol. Mass.124.0755
SMILESCCCP(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a