Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAlkaline phosphatase, germ cell type
LigandBDBM50131861
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157081
Ki 200000±n/a nM
Citation Swierczek, KPandey, ASPeters, JWHengge, AC A comparison of phosphonothioic acids with phosphonic acids as phosphatase inhibitors. J Med Chem46:3703-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Alkaline phosphatase, germ cell type
Name:Alkaline phosphatase, germ cell type
Synonyms:Alkaline phosphatase placental-like | placental-like alkaline phosphatase preproprotein
Type:PROTEIN
Mol. Mass.:57374.31
Organism:Homo sapiens (Human)
Description:ChEMBL_29964
Residue:532
Sequence:
MQGPWVLLLLGLRLQLSLGIIPVEEENPDFWNRQAAEALGAAKKLQPAQTAAKNLIIFLG
DGMGVSTVTAARILKGQKKDKLGPETFLAMDRFPYVALSKTYSVDKHVPDSGATATAYLC
GVKGNFQTIGLSAAARFNQCNTTRGNEVISVMNRAKKAGKSVGVVTTTRVQHASPAGAYA
HTVNRNWYSDADVPASARQEGCQDIATQLISNMDIDVILGGGRKYMFPMGTPDPEYPDDY
SQGGTRLDGKNLVQEWLAKHQGARYVWNRTELLQASLDPSVTHLMGLFEPGDMKYEIHRD
STLDPSLMEMTEAALLLLSRNPRGFFLFVEGGRIDHGHHESRAYRALTETIMFDDAIERA
GQLTSEEDTLSLVTADHSHVFSFGGYPLRGSSIFGLAPGKARDRKAYTVLLYGNGPGYVL
KDGARPDVTESESGSPEYRQQSAVPLDGETHAGEDVAVFARGPQAHLVHGVQEQTFIAHV
MAFAACLEPYTACDLAPRAGTTDAAHPGPSVVPALLPLLAGTLLLLGTATAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131861
NameBDBM50131861
Synonyms:Benzyl-phosphonothioic acid | CHEMBL123163
TypeSmall organic molecule
Emp. Form.C7H9O2PS
Mol. Mass.188.184
SMILESOP(O)(=S)Cc1ccccc1
Structure
n/a