Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerine/threonine-protein phosphatase
LigandBDBM50131869
Substrate/Competitorn/a
Meas. Tech.ChEMBL_96757
Ki 17000000±n/a nM
Citation Swierczek, KPandey, ASPeters, JWHengge, AC A comparison of phosphonothioic acids with phosphonic acids as phosphatase inhibitors. J Med Chem46:3703-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serine/threonine-protein phosphatase
Name:Serine/threonine-protein phosphatase
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:25214.95
Organism:Enterobacteria phage lambda
Description:ChEMBL_96757
Residue:221
Sequence:
MRYYEKIDGSKYRNIWVVGDLHGCYTNLMNKLDTIGFDNKKDLLISVGDLVDRGAENVEC
LELITFPWFRAVRGNHEQMMIDGLSERGNVNHWLLNGGGWFFNLDYDKEILAKALAHKAD
ELPLIIELVSKDKKYVICHADYPFDEYEFGKPVDHQQVIWNRERISNSQNGIVKEIKGAD
TFIFGHTPAVKPLKFANQMYIDTGAVFCGNLTLIQVQGEGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50131869
NameBDBM50131869
Synonyms:CHEMBL122577 | Methyl-phosphonothioic acid
TypeSmall organic molecule
Emp. Form.CH5O2PS
Mol. Mass.112.088
SMILESCP(O)(O)=S
Structure
n/a