Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 5 (MC5R)
LigandBDBM50134947
Substrate/Competitorn/a
Meas. Tech.ChEMBL_106655
Ki 17±n/a nM
Citation Balse-Srinivasan, PGrieco, PCai, MTrivedi, DHruby, VJ Structure-activity relationships of gamma-MSH analogues at the human melanocortin MC3, MC4, and MC5 receptors. Discovery of highly selective hMC3R, hMC4R, and hMC5R analogues. J Med Chem46:4965-73 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 5 (MC5R)
Name:Melanocortin receptor (M4 and M5)
Synonyms:MC-2 | MC5-R | MC5R | Melanocortin MC5 | Melanocortin receptor 5
Type:Enzyme
Mol. Mass.:36612.92
Organism:Homo sapiens (Human)
Description:P33032
Residue:325
Sequence:
MNSSFHLHFLDLNLNATEGNLSGPNVKNKSSPCEDMGIAVEVFLTLGVISLLENILVIGA
IVKNKNLHSPMYFFVCSLAVADMLVSMSSAWETITIYLLNNKHLVIADAFVRHIDNVFDS
MICISVVASMCSLLAIAVDRYVTIFYALRYHHIMTARRSGAIIAGIWAFCTGCGIVFILY
SESTYVILCLISMFFAMLFLLVSLYIHMFLLARTHVKRIAALPGASSARQRTSMQGAVTV
TMLLGVFTVCWAPFFLHLTLMLSCPQNLYCSRFMSHFNMYLILIMCNSVMDPLIYAFRSQ
EMRKTFKEIICCRGFRIACSFPRRD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50134947
NameBDBM50134947
Synonyms:CHEMBL2370963 | H-Tyr-Val-Nle-Gly-His-Phe-Arg-D-Nal(2')-Asp-Arg-Phe-Gly-NH2
TypeSmall organic molecule
Emp. Form.C77H103N21O15
Mol. Mass.1562.7734
SMILESCCCC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(=O)NCC(=O)N[C@@H](Cc1c[nH]cn1)C(=O)N[C@@H](Cc1ccccc1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@H](Cc1ccc2ccccc2c1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(N)=O |wU:42.44,8.22,87.92,wD:79.84,32.33,64.67,98.103,12.13,53.56,4.3,(.12,-14.56,;-1.22,-13.8,;-1.21,-12.3,;-2.57,-11.56,;-2.54,-10.05,;-3.91,-9.29,;-5.27,-10.03,;-5.27,-11.53,;-6.6,-9.26,;-7.96,-10.02,;-9.3,-9.26,;-9.3,-7.76,;-10.66,-10,;-11.99,-9.23,;-10.69,-11.5,;-9.33,-12.24,;-9.33,-13.76,;-7.99,-14.51,;-6.64,-13.77,;-5.3,-14.54,;-6.63,-12.27,;-7.97,-11.52,;-6.6,-7.77,;-5.24,-7.04,;-7.94,-7.01,;-1.19,-9.31,;-1.18,-7.8,;.15,-10.05,;1.51,-9.32,;2.85,-10.08,;2.84,-11.59,;4.21,-9.34,;5.54,-10.08,;5.54,-11.6,;6.89,-12.35,;8.32,-11.76,;9.34,-12.89,;8.55,-14.17,;7.05,-13.86,;6.9,-9.36,;6.92,-7.86,;8.26,-10.13,;9.62,-9.37,;9.6,-7.87,;10.7,-6.81,;10.28,-5.37,;11.38,-4.29,;12.89,-4.68,;13.29,-6.13,;12.21,-7.19,;10.96,-10.11,;10.93,-11.6,;12.31,-9.37,;13.66,-10.13,;13.66,-11.63,;14.99,-12.38,;14.98,-13.88,;16.32,-14.65,;16.31,-16.15,;17.66,-16.91,;14.96,-16.89,;15.02,-9.37,;15.02,-7.89,;16.35,-10.14,;17.71,-9.4,;17.73,-7.87,;16.95,-6.53,;15.41,-6.53,;14.62,-5.19,;15.39,-3.84,;14.62,-2.5,;15.39,-1.14,;16.95,-1.14,;17.73,-2.5,;16.95,-3.84,;17.73,-5.17,;19.08,-10.14,;19.07,-11.64,;20.43,-9.4,;21.77,-10.17,;21.77,-11.67,;23.11,-12.43,;24.47,-11.67,;23.11,-13.93,;23.13,-9.43,;23.13,-7.93,;24.47,-10.19,;25.83,-9.43,;25.83,-7.94,;27.21,-7.21,;27.22,-5.7,;28.57,-4.97,;28.58,-3.46,;29.93,-2.72,;27.24,-2.7,;27.18,-10.2,;27.16,-11.7,;28.52,-9.46,;29.89,-10.22,;29.88,-11.73,;31.22,-12.48,;32.57,-11.75,;33.92,-12.49,;33.92,-14,;32.55,-14.74,;31.21,-13.97,;31.24,-9.48,;31.25,-7.98,;32.58,-10.22,;33.94,-9.51,;35.28,-10.25,;36.64,-9.51,;35.28,-11.76,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a