Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3 (MC3R)
LigandBDBM50134955
Substrate/Competitorn/a
Meas. Tech.ChEMBL_106018
Ki 0.200000±n/a nM
Citation Balse-Srinivasan, PGrieco, PCai, MTrivedi, DHruby, VJ Structure-activity relationships of gamma-MSH analogues at the human melanocortin MC3, MC4, and MC5 receptors. Discovery of highly selective hMC3R, hMC4R, and hMC5R analogues. J Med Chem46:4965-73 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3 (MC3R)
Name:Melanocortin receptor (M3 and M4)
Synonyms:MC3-R | MC3R | Melanocortin MC3 | Melanocortin receptor (M3 and M4) | Melanocortin receptor 3
Type:Enzyme
Mol. Mass.:36044.86
Organism:Homo sapiens (Human)
Description:P41968
Residue:323
Sequence:
MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50134955
NameBDBM50134955
Synonyms:CHEMBL2370968 | H-Tyr-Val-Nle-Gly-Pro-D-Nal(2')-Arg-Trp-Asp-Arg-Phe-Gly-NH2
TypeSmall organic molecule
Emp. Form.C78H104N20O15
Mol. Mass.1561.7854
SMILESCCCC[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)Cc1ccc(O)cc1)C(C)C)C(=O)NCC(=O)N1CCC[C@H]1C(=O)N[C@H](Cc1ccc2ccccc2c1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H](Cc1ccccc1)C(=O)NCC(N)=O |wU:4.4,79.84,65.68,54.57,wD:35.37,8.8,39.40,98.103,87.92,12.12,(2.89,-5.82,;3.92,-6.96,;3.45,-8.43,;4.48,-9.57,;4,-11.03,;2.49,-11.35,;1.46,-10.21,;1.94,-8.75,;-.04,-10.53,;-1.07,-9.39,;-2.58,-9.71,;-3.06,-11.17,;-3.61,-8.56,;-3.13,-7.1,;-5.12,-8.88,;-6.15,-7.74,;-5.67,-6.27,;-6.7,-5.13,;-8.21,-5.45,;-9.24,-4.3,;-8.68,-6.91,;-7.65,-8.06,;-.52,-12,;.51,-13.14,;-2.03,-12.32,;5.03,-12.18,;4.55,-13.64,;6.54,-11.86,;7.57,-13,;9.07,-12.68,;9.55,-11.22,;10.1,-13.83,;9.78,-15.33,;11.12,-16.1,;12.26,-15.07,;11.64,-13.67,;12.41,-12.33,;13.95,-12.33,;11.64,-11,;12.41,-9.67,;11.64,-8.33,;10.1,-8.33,;9.33,-9.67,;7.79,-9.67,;7.02,-8.33,;5.48,-8.33,;4.71,-7,;5.48,-5.66,;7.02,-5.66,;7.79,-7,;9.33,-7,;13.95,-9.67,;13.78,-8.13,;14.72,-11,;16.26,-11,;17.03,-9.67,;16.26,-8.33,;14.72,-8.33,;13.95,-7,;14.72,-5.66,;13.95,-4.33,;16.26,-5.66,;17.03,-12.33,;16.26,-13.67,;18.57,-12.33,;19.34,-11,;18.57,-9.67,;19.34,-8.33,;20.87,-8.17,;21.19,-6.66,;19.85,-5.89,;19.53,-4.39,;18.07,-3.91,;16.92,-4.94,;17.24,-6.45,;18.71,-6.92,;20.88,-11,;21.65,-9.67,;21.65,-12.33,;23.19,-12.33,;23.96,-11,;25.5,-11,;26.27,-9.67,;26.27,-12.33,;23.96,-13.67,;23.19,-15,;25.5,-13.67,;26.27,-15,;25.5,-16.33,;23.96,-16.33,;23.19,-17.67,;23.96,-19,;23.19,-20.33,;23.96,-21.67,;21.65,-20.33,;27.81,-15,;28.58,-13.67,;28.58,-16.33,;30.12,-16.33,;30.89,-17.67,;30.12,-19,;28.58,-19,;27.81,-20.33,;28.58,-21.67,;30.12,-21.67,;30.89,-20.33,;30.89,-15,;32.43,-15,;30.12,-13.67,;30.89,-12.33,;30.12,-11,;28.58,-11,;30.89,-9.67,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a