Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProlyl endopeptidase
LigandBDBM50135633
Substrate/Competitorn/a
Meas. Tech.ChEMBL_157490
Ki 0.280000±n/a nM
Citation Bal, GVan der Veken, PAntonov, DLambeir, AMGrellier, PCroft, SLAugustyns, KHaemers, A Prolylisoxazoles: potent inhibitors of prolyloligopeptidase with antitrypanosomal activity. Bioorg Med Chem Lett13:2875-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Prolyl endopeptidase
Name:Prolyl endopeptidase
Synonyms:PE | PEP | POP | PREP | Post-proline cleaving enzyme | Prolyl oligopeptidase
Type:Enzyme
Mol. Mass.:80688.50
Organism:Homo sapiens (Human)
Description:P48147
Residue:710
Sequence:
MLSLQYPDVYRDETAVQDYHGHKICDPYAWLEDPDSEQTKAFVEAQNKITVPFLEQCPIR
GLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNILS
DDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFSCMAWTH
DGKGMFYNSYPQQDGKSDGTETSTNLHQKLYYHVLGTDQSEDILCAEFPDEPKWMGGAEL
SDDGRYVLLSIREGCDPVNRLWYCDLQQESSGIAGILKWVKLIDNFEGEYDYVTNEGTVF
TFKTNRQSPNYRVINIDFRDPEESKWKVLVPEHEKDVLEWIACVRSNFLVLCYLHDVKNI
LQLHDLTTGALLKTFPLDVGSIVGYSGQKKDTEIFYQFTSFLSPGIIYHCDLTKEELEPR
VFREVTVKGIDASDYQTVQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISI
TPNYSVSRLIFVRHMGGILAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKE
GYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKYTIGHAWTTDYG
CSDSKQHFEWLVKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIV
GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNVDWIP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135633
NameBDBM50135633
Synonyms:(S)-2-[(S)-2-(5-Benzyloxymethyl-isoxazole-3-carbonyl)-pyrrolidine-1-carbonyl]-pyrrolidine-1-carboxylic acid benzyl ester | (S)-benzyl 2-((S)-2-(5-(benzyloxymethyl)isoxazole-3-carbonyl)pyrrolidine-1-carbonyl)pyrrolidine-1-carboxylate | CHEMBL318284
TypeSmall organic molecule
Emp. Form.C29H31N3O6
Mol. Mass.517.5729
SMILESO=C(OCc1ccccc1)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)c1cc(COCc2ccccc2)on1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a