Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFarnesyl diphosphate synthase
LigandBDBM50135836
Substrate/Competitorn/a
Meas. Tech.ChEMBL_69705
IC50 110±n/a nM
Citation Sanders, JMGómez, AOMao, JMeints, GAVan Brussel, EMBurzynska, AKafarski, PGonzález-Pacanowska, DOldfield, E 3-D QSAR investigations of the inhibition of Leishmania major farnesyl pyrophosphate synthase by bisphosphonates. J Med Chem46:5171-83 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Farnesyl diphosphate synthase
Name:Farnesyl diphosphate synthase
Synonyms:Dimethylallyltranstransferase | FPP synthase | FPP synthetase | FPS | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | P14324
Type:Enzyme
Mol. Mass.:48272.89
Organism:Homo sapiens (Human)
Description:P14324
Residue:419
Sequence:
MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50135836
NameBDBM50135836
Synonyms:1-(2-Hydroxy-2,2-bis-phosphono-ethyl)-3H-imidazol-1-ium | CHEMBL340034 | ZOLEDRONIC ACID
TypeSmall organic molecule
Emp. Form.C5H11N2O7P2
Mol. Mass.273.097
SMILESOC(C[n+]1cc[nH]c1)(P(O)(O)=O)P(O)(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a