Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetGlycogen Phosphorylase (PYGL)
LigandBDBM50136446
Substrate/Competitorn/a
Meas. Tech.ChEBML_99041
IC50 45±n/a nM
Citation Rosauer, KGOgawa, AKWilloughby, CAEllsworth, KPGeissler, WMMyers, RWDeng, QChapman, KTHarris, GMoller, DE Novel 3,4-dihydroquinolin-2(1H)-one inhibitors of human glycogen phosphorylase a. Bioorg Med Chem Lett13:4385-8 (2003) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Glycogen Phosphorylase (PYGL)
Name:Liver glycogen phosphorylase
Synonyms:Glycogen Phosphorylase, liver form
Type:Homodimer
Mol. Mass.:97153.98
Organism:Homo sapiens (Human)
Description:Dimers associate into a tetramer to form the enzymatically active phosphorylase A.
Residue:847
Sequence:
MAKPLTDQEKRRQISIRGIVGVENVAELKKSFNRHLHFTLVKDRNVATTRDYYFALAHTV
RDHLVGRWIRTQQHYYDKCPKRVYYLSLEFYMGRTLQNTMINLGLQNACDEAIYQLGLDI
EELEEIEEDAGLGNGGLGRLAACFLDSMATLGLAAYGYGIRYEYGIFNQKIRDGWQVEEA
DDWLRYGNPWEKSRPEFMLPVHFYGKVEHTNTGTKWIDTQVVLALPYDTPVPGYMNNTVN
TMRLWSARAPNDFNLRDFNVGDYIQAVLDRNLAENISRVLYPNDNFFEGKELRLKQEYFV
VAATLQDIIRRFKASKFGSTRGAGTVFDAFPDQVAIQLNDTHPALAIPELMRIFVDIEKL
PWSKAWELTQKTFAYTNHTVLPEALERWPVDLVEKLLPRHLEIIYEINQKHLDRIVALFP
KDVDRLRRMSLIEEEGSKRINMAHLCIVGSHAVNGVAKIHSDIVKTKVFKDFSELEPDKF
QNKTNGITPRRWLLLCNPGLAELIAEKIGEDYVKDLSQLTKLHSFLGDDVFLRELAKVKQ
ENKLKFSQFLETEYKVKINPSSMFDVQVKRIHEYKRQLLNCLHVITMYNRIKKDPKKLFV
PRTVIIGGKAAPGYHMAKMIIKLITSVADVVNNDPMVGSKLKVIFLENYRVSLAEKVIPA
TDLSEQISTAGTEASGTGNMKFMLNGALTIGTMDGANVEMAEEAGEENLFIFGMRIDDVA
ALDKKGYEAKEYYEALPELKLVIDQIDNGFFSPKQPDLFKDIINMLFYHDRFKVFADYEA
YVKCQDKVSQLYMNPKAWNTMVLKNIAASGKFSSDRTIKEYAQNIWNVEPSDLKISLSNE
SNKVNGN
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50136446
NameBDBM50136446
Synonyms:1-{(S)-2-[(5-Chloro-1H-indole-2-carbonyl)-amino]-3-phenyl-propionyl}-azetidine-3-carboxylic acid | CHEMBL335954 | CP-403,700 | CP-403700 | [5-CHLORO-1H-INDOL-2-CARBONYL-PHENYLALANINYL]-AZETIDINE-3-CARBOXYLIC ACID
TypeSmall organic molecule
Emp. Form.C22H20ClN3O4
Mol. Mass.425.865
SMILESOC(=O)C1CN(C1)C(=O)[C@H](Cc1ccccc1)NC(=O)c1cc2cc(Cl)ccc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a