Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTrypsin-1
LigandBDBM50138662
Substrate/Competitorn/a
Meas. Tech.ChEMBL_212906
Ki 2080±n/a nM
Citation Wendt, MDRockway, TWGeyer, AMcClellan, WWeitzberg, MZhao, XMantei, RNienaber, VLStewart, KKlinghofer, VGiranda, VL Identification of novel binding interactions in the development of potent, selective 2-naphthamidine inhibitors of urokinase. Synthesis, structural analysis, and SAR of N-phenyl amide 6-substitution. J Med Chem47:303-24 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Trypsin-1
Name:Trypsin-1
Synonyms:Alpha-trypsin chain 1 | Alpha-trypsin chain 2 | Beta-trypsin | Cationic trypsinogen | PRSS1 | Serine protease 1 | Trypsin | Trypsin I
Type:Enzyme
Mol. Mass.:26557.80
Organism:Homo sapiens (Human)
Description:P07477
Residue:247
Sequence:
MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVS
AGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVIN
ARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKIT
SNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIK
NTIAANS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50138662
NameBDBM50138662
Synonyms:6-Carbamimidoyl-naphthalene-2-carboxylic acid (4-aminomethyl-phenyl)-amide | 6-[(Z)-AMINO(IMINO)METHYL]-N-[4-(AMINOMETHYL)PHENYL]-2-NAPHTHAMIDE | CHEMBL324168 | N-(4-(aminomethyl)phenyl)-6-carbamimidoyl-2-naphthamide | uPa_9
TypeSmall organic molecule
Emp. Form.C19H18N4O
Mol. Mass.318.3724
SMILESNCc1ccc(NC(=O)c2ccc3cc(ccc3c2)C(N)=N)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a