Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetKallikrein-1 (KLK1)
LigandBDBM50140407
Substrate/Competitorn/a
Meas. Tech.ChEBML_92384
IC50>10000±n/a nM
Citation Jia, ZJWu, YHuang, WZhang, PSong, YWoolfrey, JSinha, UArfsten, AEEdwards, STHutchaleelaha, AHollennbach, SJLambing, JLScarborough, RMZhu, BY 1-(2-Naphthyl)-1H-pyrazole-5-carboxylamides as potent factor Xa inhibitors. Part 3: Design, synthesis and SAR of orally bioavailable benzamidine-P4 inhibitors. Bioorg Med Chem Lett14:1229-34 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Kallikrein-1 (KLK1)
Name:Kallikrein 1
Synonyms:Kallikrein 1 | Kallikrein-1 | Kidney/pancreas/salivary gland kallikrein | Tissue kallikrein
Type:Enzyme
Mol. Mass.:28874.69
Organism:Homo sapiens (Human)
Description:P06870
Residue:262
Sequence:
MWFLVLCLALSLGGTGAAPPIQSRIVGGWECEQHSQPWQAALYHFSTFQCGGILVHRQWV
LTAAHCISDNYQLWLGRHNLFDDENTAQFVHVSESFPHPGFNMSLLENHTRQADEDYSHD
LMLLRLTEPADTITDAVKVVELPTEEPEVGSTCLASGWGSIEPENFSFPDDLQCVDLKIL
PNDECKKAHVQKVTDFMLCVGHLEGGKDTCVGDSGGPLMCDGVLQGVTSWGYVPCGTPNK
PSVAVRVLSYVKWIEDTIAENS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50140407
NameBDBM50140407
Synonyms:2-(3-Fluoro-naphthalen-2-yl)-5-methyl-2H-pyrazole-3-carboxylic acid [4-(N,N-dimethyl-carbamimidoyl)-2-fluoro-phenyl]-amide | CHEMBL21140
TypeSmall organic molecule
Emp. Form.C24H21F2N5O
Mol. Mass.433.4532
SMILESCN(C)C(=N)c1ccc(NC(=O)c2cc(C)nn2-c2cc3ccccc3cc2F)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a