Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetVitamin K-dependent protein C
LigandBDBM50140424
Substrate/Competitorn/a
Meas. Tech.ChEBML_27867
IC50>10000±n/a nM
Citation Jia, ZJWu, YHuang, WZhang, PSong, YWoolfrey, JSinha, UArfsten, AEEdwards, STHutchaleelaha, AHollennbach, SJLambing, JLScarborough, RMZhu, BY 1-(2-Naphthyl)-1H-pyrazole-5-carboxylamides as potent factor Xa inhibitors. Part 3: Design, synthesis and SAR of orally bioavailable benzamidine-P4 inhibitors. Bioorg Med Chem Lett14:1229-34 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Vitamin K-dependent protein C
Name:Vitamin K-dependent protein C
Synonyms:Activated protein C cofactor | Anticoagulant protein C | Apolipoprotein H | Autoprothrombin IIA | Blood coagulation factor XIV | Coagulation factor V | Coagulation factor V heavy chain | Coagulation factor V light chain | Endothelial protein C receptor | Proaccelerin, labile factor | Vitamin K-dependent protein C precursor
Type:Enzyme
Mol. Mass.:52067.73
Organism:Homo sapiens (Human)
Description:n/a
Residue:461
Sequence:
MWQLTSLLLFVATWGISGTPAPLDSVFSSSERAHQVLRIRKRANSFLEELRHSSLERECI
EEICDFEEAKEIFQNVDDTLAFWSKHVDGDQCLVLPLEHPCASLCCGHGTCIDGIGSFSC
DCRSGWEGRFCQREVSFLNCSLDNGGCTHYCLEEVGWRRCSCAPGYKLGDDLLQCHPAVK
FPCGRPWKRMEKKRSHLKRDTEDQEDQVDPRLIDGKMTRRGDSPWQVVLLDSKKKLACGA
VLIHPSWVLTAAHCMDESKKLLVRLGEYDLRRWEKWELDLDIKEVFVHPNYSKSTTDNDI
ALLHLAQPATLSQTIVPICLPDSGLAERELNQAGQETLVTGWGYHSSREKEAKRNRTFVL
NFIKIPVVPHNECSEVMSNMVSENMLCAGILGDRQDACEGDSGGPMVASFHGTWFLVGLV
SWGEGCGLLHNYGVYTKVSRYLDWIHGHIRDKEAPQKSWAP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50140424
NameBDBM50140424
Synonyms:2-(6-Chloro-naphthalen-2-yl)-5-methyl-2H-pyrazole-3-carboxylic acid [4-(N,N-dimethyl-carbamimidoyl)-2-fluoro-phenyl]-amide | CHEMBL20918
TypeSmall organic molecule
Emp. Form.C24H21ClFN5O
Mol. Mass.449.908
SMILESCN(C)C(=N)c1ccc(NC(=O)c2cc(C)nn2-c2ccc3cc(Cl)ccc3c2)c(F)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a