Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase AmpC
LigandBDBM50076672
Substrate/Competitorn/a
Meas. Tech.ChEBML_197644
IC50 10000±n/a nM
Citation Buynak, JDChen, HVogeti, LGadhachanda, VRBuchanan, CAPalzkill, TShaw, RWSpencer, JWalsh, TR Penicillin-derived inhibitors that simultaneously target both metallo- and serine-beta-lactamases. Bioorg Med Chem Lett14:1299-304 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase AmpC
Name:Beta-lactamase AmpC
Synonyms:Beta-lactamase | Beta-lactamase (AmpC) | Cephalosporinase | Escherichia coli K-12
Type:Protien
Mol. Mass.:41561.62
Organism:Escherichia coli
Description:P00811
Residue:377
Sequence:
MFKTTLCALLITASCSTFAAPQQINDIVHRTITPLIEQQKIPGMAVAVIYQGKPYYFTWG
YADIAKKQPVTQQTLFELGSVSKTFTGVLGGDAIARGEIKLSDPTTKYWPELTAKQWNGI
TLLHLATYTAGGLPLQVPDEVKSSSDLLRFYQNWQPAWAPGTQRLYANSSIGLFGALAVK
PSGLSFEQAMQTRVFQPLKLNHTWINVPPAEEKNYAWGYREGKAVHVSPGALDAEAYGVK
STIEDMARWVQSNLKPLDINEKTLQQGIQLAQSRYWQTGDMYQGLGWEMLDWPVNPDSII
NGSDNKIALAARPVKAITPPTPAVRASWVHKTGATGGFGSYVAFIPEKELGIVMLANKNY
PNPARVDAAWQILNALQ
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50076672
NameBDBM50076672
Synonyms:(2S,5R,6S)-6-Hydroxymethyl-3,3-dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid | CHEMBL24878 | Sodium; (2S,5R,6S)-6-hydroxymethyl-3,3-dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylate
TypeSmall organic molecule
Emp. Form.C9H13NO6S
Mol. Mass.263.268
SMILESCC1(C)[C@@H](N2[C@@H]([C@@H](CO)C2=O)S1(=O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a