Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBeta-lactamase L1
LigandBDBM50140669
Substrate/Competitorn/a
Meas. Tech.ChEMBL_104646
IC50 7600±n/a nM
Citation Buynak, JDChen, HVogeti, LGadhachanda, VRBuchanan, CAPalzkill, TShaw, RWSpencer, JWalsh, TR Penicillin-derived inhibitors that simultaneously target both metallo- and serine-beta-lactamases. Bioorg Med Chem Lett14:1299-304 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Beta-lactamase L1
Name:Beta-lactamase L1
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:30803.13
Organism:Stenotrophomonas maltophilia
Description:ChEMBL_1500319
Residue:290
Sequence:
MRSTLLAFALAVALPAAHTSAAEVPLPQLRAYTVDASWLQPMAPLQIADHTWQIGTEDLT
ALLVQTPDGAVLLDGGMPQMASHLLDNMKARGVTPRDLRLILLSHAHADHAGPVAELKRR
TGAKVAANAESAVLLARGGSDDLHFGDGITYPPANADRIVMDGEVITVGGIVFTAHFMAG
HTPGSTAWTWTDTRNGKPVRIAYADSLSAPGYQLQGNPRYPHLIEDYRRSFATVRALPCD
VLLTPHPGASNWDYAAGARAGAKALTCKAYADAAEQKFDGQLAKETAGAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50140669
NameBDBM50140669
Synonyms:(2S,5R,6S)-6-Mercapto-3,3-dimethyl-4,4,7-trioxo-4lambda*6*-thia-1-aza-bicyclo[3.2.0]heptane-2-carboxylic acid | CHEMBL26275
TypeSmall organic molecule
Emp. Form.C8H11NO5S2
Mol. Mass.265.307
SMILESCC1(C)[C@@H](N2[C@@H]([C@@H](S)C2=O)S1(=O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a