Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDNA topoisomerase I (Topo I)
LigandBDBM50142519
Substrate/Competitorn/a
Meas. Tech.ChEMBL_54044
Ki 400±n/a nM
Citation Abdel-Aziz, MMatsuda, KOtsuka, MUyeda, MOkawara, TSuzuki, K Inhibitory activities against topoisomerase I and II by polyhydroxybenzoyl amide derivatives and their structure-activity relationship. Bioorg Med Chem Lett14:1669-72 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
DNA topoisomerase I (Topo I)
Name:DNA topoisomerase I
Synonyms:DNA topoisomerase I
Type:Enzyme
Mol. Mass.:90771.02
Organism:Homo sapiens (Human)
Description:P11387
Residue:765
Sequence:
MSGDHLHNDSQIEADFRLNDSHKHKDKHKDREHRHKEHKKEKDREKSKHSNSEHKDSEKK
HKEKEKTKHKDGSSEKHKDKHKDRDKEKRKEEKVRASGDAKIKKEKENGFSSPPQIKDEP
EDDGYFVPPKEDIKPLKRPRDEDDADYKPKKIKTEDTKKEKKRKLEEEEDGKLKKPKNKD
KDKKVPEPDNKKKKPKKEEEQKWKWWEEERYPEGIKWKFLEHKGPVFAPPYEPLPENVKF
YYDGKVMKLSPKAEEVATFFAKMLDHEYTTKEIFRKNFFKDWRKEMTNEEKNIITNLSKC
DFTQMSQYFKAQTEARKQMSKEEKLKIKEENEKLLKEYGFCIMDNHKERIANFKIEPPGL
FRGRGNHPKMGMLKRRIMPEDIIINCSKDAKVPSPPPGHKWKEVRHDNKVTWLVSWTENI
QGSIKYIMLNPSSRIKGEKDWQKYETARRLKKCVDKIRNQYREDWKSKEMKVRQRAVALY
FIDKLALRAGNEKEEGETADTVGCCSLRVEHINLHPELDGQEYVVEFDFLGKDSIRYYNK
VPVEKRVFKNLQLFMENKQPEDDLFDRLNTGILNKHLQDLMEGLTAKVFRTYNASITLQQ
QLKELTAPDENIPAKILSYNRANRAVAILCNHQRAPPKTFEKSMMNLQTKIDAKKEQLAD
ARRDLKSAKADAKVMKDAKTKKVVESKKKAVQRLEEQLMKLEVQATDREENKQIALGTSK
LNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50142519
NameBDBM50142519
Synonyms:CHEMBL47027 | N-[2-(3,4,5-triihydroxy-benzoylamino)-phenyl]-3,4,5-trihydroxy-benzamide
TypeSmall organic molecule
Emp. Form.C20H16N2O8
Mol. Mass.412.3496
SMILESOc1cc(cc(O)c1O)C(=O)Nc1ccccc1NC(=O)c1cc(O)c(O)c(O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a