Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetNeuronal acetylcholine receptor protein alpha-3/beta-4 subunit
LigandBDBM50100713
Substrate/Competitorn/a
Meas. Tech.ChEMBL_143407
Ki 7.2±n/a nM
Citation Carroll, FI Epibatidine structure-activity relationships. Bioorg Med Chem Lett14:1889-96 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Neuronal acetylcholine receptor protein alpha-3/beta-4 subunit
Name:Neuronal acetylcholine receptor protein alpha-3/beta-4 subunit
Synonyms:Neuronal acetylcholine receptor; alpha3/beta4 | nAChR subtypes alpha3 beta4
Type:n/a
Mol. Mass.:n/a
Description:ASSAY_ID of EBI is 143402
Components:This complex has 2 components.
Component 1
Name:Neuronal acetylcholine receptor subunit alpha-3
Synonyms:Cholinergic, Nicotinic Alpha3Beta2 | Neuronal acetylcholine receptor protein alpha-3 subunit | Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Type:Enzyme
Mol. Mass.:56995.52
Organism:Rattus norvegicus (Rat)
Description:P04757
Residue:499
Sequence:
MGVVLLPPPLSMLMLVLMLLPAASASEAEHRLFQYLFEDYNEIIRPVANVSHPVIIQFEV
SMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNN
ADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAK
IDLVLIGSSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTI
NLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGE
YLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNLLPRVMFMTRPTSGEGDT
PKTRTFYGAELSNLNCFSRADSKSCKEGYPCQDGTCGYCHHRRVKISNFSANLTRSSSSE
SVNAVLSLSALSPEIKEAIQSVKYIAENMKAQNVAKEIQDDWKYVAMVIDRIFLWVFILV
CILGTAGLFLQPLMARDDT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:Neuronal acetylcholine receptor subunit beta-4
Synonyms:Neuronal acetylcholine receptor protein beta-4 subunit | Nicotinic acetylcholine receptor alpha6/alpha3/beta4
Type:Enzyme
Mol. Mass.:55863.89
Organism:Rattus norvegicus (Rat)
Description:P12392
Residue:495
Sequence:
MRGTPLLLVSLFSLLQDGDCRLANAEEKLMDDLLNKTRYNNLIRPATSSSQLISIRLELS
LSQLISVNEREQIMTTSIWLKQEWTDYRLAWNSSCYEGVNILRIPAKRVWLPDIVLYNNA
DGTYEVSVYTNVIVRSNGSIQWLPPAIYKSACKIEVKHFPFDQQNCTLKFRSWTYDHTEI
DMVLKSPTAIMDDFTPSGEWDIVALPGRRTVNPQDPSYVDVTYDFIIKRKPLFYTINLII
PCVLITSLAILVFYLPSDCGEKMTLCISVLLALTFFLLLISKIVPPTSLDIPLIGKYLLF
TMVLVTFSIVTTVCVLNVHHRSPSTHTMASWVKECFLHKLPTFLFMKRPGLEVSLVRVPH
PSQLHLATADTAATSALGPTSPSNLYGSSMYFVNPVPAAPKSAVSSHTAGLPRDARLRSS
GRFREDLQEALEGVSFIAQHLESDDRDQSVIEDWKFVAMVVDRLFLWVFVFVCILGTMGL
FLPPLFQIHAPSKDS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50100713
NameBDBM50100713
Synonyms:5-(7-Aza-bicyclo[2.2.1]hept-2-yl)-pyridin-2-ylamine | CHEMBL56358
TypeSmall organic molecule
Emp. Form.C11H15N3
Mol. Mass.189.2569
SMILESNc1ccc(cn1)C1CC2CCC1N2 |THB:4:7:13:11.10|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a