Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetPlasmin
LigandBDBM50144092
Substrate/Competitorn/a
Meas. Tech.ChEBML_155584
IC50>10000±n/a nM
Citation Jia, ZJSu, TZuckett, JFWu, YGoldman, EALi, WZhang, PClizbe, LASong, YBauer, SMHuang, WWoolfrey, JSinha, UArfsten, AEHutchaleelaha, AHollenbach, SJLambing, JLScarborough, RMZhu, BY N,N-Dialkylated 4-(4-arylsulfonylpiperazine-1-carbonyl)-benzamidines and 4-((4-arylsulfonyl)-2-oxo-piperazin-1-ylmethyl)-benzamidines as potent factor Xa inhibitors. Bioorg Med Chem Lett14:2073-8 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Plasmin
Name:Plasminogen
Synonyms:Plg
Type:Protein
Mol. Mass.:90541.87
Organism:Rattus norvegicus
Description:Q01177
Residue:812
Sequence:
MDHKEIILLFLLFLKPGQGDSLDGYVSTQGASLHSLTKKQLAAGSIADCLAKCEGETDFI
CRSFQYHSKEQQCVIMAENSKTSSIIRMRDVILFEKRVYLSECKTGIGKGYRGTMSKTKT
GVTCQKWSDTSPHVPKYSPSTHPSEGLEENYCRNPDNDEQGPWCYTTDPDQRYEYCNIPE
CEEECMYCSGEKYEGKISKTMSGLDCQSWDSQSPHAHGYIPAKFPSKNLKMNYCRNPDGE
PRPWCFTTDPNKRWEYCDIPRCTTPPPPPGPTYQCLKGRGENYRGTVSVTASGKTCQRWS
EQTPHRHNRTPENFPCKNLEENYCRNPDGETAPWCYTTDSQLRWEYCEIPSCGSSVSPDQ
SDSSVLPEQTPVVQECYQGNGKSYRGTSSTTNTGKKCQSWVSMTPHSHSKTPANFPDAGL
EMNYCRNPDNDQRGPWCFTTDPSVRWEYCNLKRCSETGGGVAESAIVPQVPSAPGTSETD
CMYGNGKEYRGKTAVTAAGTPCQEWAAQEPHSHRIFTPQTNPRAGLEKNYCRNPDGDVNG
PWCYTMNPRKLYDYCNIPLCASLSSFECGKPQVEPKKCPGRVVGGCVANPHSWPWQISLR
TRFSGQHFCGGTLISPEWVLTAAHCLEKSSRPEFYKVILGAHEERILGSDVQQIAVTKLV
LEPNDADIALLKLSRPATITDNVIPACLPSPNYVVADRTLCYITGWGETKGTPGAGRLKE
AQLPVIENKVCNRAEYLNNRVKSTELCAGHLAGGIDSCQGDSGGPLVCFEKDKYILQGVT
SWGLGCARPNKPGVYVRVSRYVNWIEREMRND
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50144092
NameBDBM50144092
Synonyms:CHEMBL294121 | [4-(5-Chloro-1H-indole-2-sulfonyl)-piperazin-1-yl]-[4-(1-methyl-4,5-dihydro-1H-imidazol-2-yl)-phenyl]-methanone
TypeSmall organic molecule
Emp. Form.C23H24ClN5O3S
Mol. Mass.485.986
SMILESCN1CCN=C1c1ccc(cc1)C(=O)N1CCN(CC1)S(=O)(=O)c1cc2cc(Cl)ccc2[nH]1 |c:4|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a