Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcidic fibroblast growth factor
LigandBDBM50144523
Substrate/Competitorn/a
Meas. Tech.ChEMBL_70464
Kd 2340000±n/a nM
Citation Liu, LPing Li, CCochran, SFerro, V Application of the four-component Ugi condensation for the preparation of sulfated glycoconjugate libraries. Bioorg Med Chem Lett14:2221-6 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acidic fibroblast growth factor
Name:Acidic fibroblast growth factor
Synonyms:Acidic fibroblast growth factor | Beta-endothelial cell growth factor | ECGF-beta | Fibroblast growth factor 1 (FGF-1) | HBGF-1 | Heparin-binding growth factor 1 | aFGF
Type:Protein
Mol. Mass.:17461.01
Organism:Homo sapiens (Human)
Description:P05230
Residue:155
Sequence:
MAEGEITTFTALTEKFNLPPGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQ
LSAESVGEVYIKSTETGQYLAMDTDGLLYGSQTPNEECLFLERLEENHYNTYISKKHAEK
NWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50144523
NameBDBM50144523
Synonyms:CHEMBL305519 | Sodium sulfated glycoconjugate derivative
TypeSmall organic molecule
Emp. Form.C16H23N2O23S5
Mol. Mass.771.681
SMILES[O-]S(=O)(=O)OCCN(CC(=O)NC1CCCCC1)C(=O)C1OC(OS([O-])(=O)=O)C(OS([O-])(=O)=O)C(OS([O-])(=O)=O)C1OS([O-])(=O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a