Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelatonin receptor 1B
LigandBDBM50149169
Substrate/Competitorn/a
Meas. Tech.ChEBML_104938
EC50 0.740000±n/a nM
Citation Sun, LQChen, JBruce, MDeskus, JAEpperson, JRTakaki, KJohnson, GIben, LMahle, CDRyan, EXu, C Synthesis and structure-activity relationship of novel benzoxazole derivatives as melatonin receptor agonists. Bioorg Med Chem Lett14:3799-802 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melatonin receptor 1B
Name:Melatonin receptor 1B
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:40205.08
Organism:Rattus norvegicus
Description:ChEMBL_104938
Residue:364
Sequence:
MPDNSSIANCCAASGLAARPSWPGSAEAEPPETPRAPWVAPMLSTVVIVTTAVDFVGNLL
VILSVLRNRKLRNAGNLFVVNLALADLVVALYPYPLILVAILHDGWVLGEIHCKASAFVM
GLSVIGSVFNITAIAINRYWCICHSATYHRACSQWHAPLYISLIWLLTLVALVPNFFVGS
LEYDPRIYSCTFIQTASTQYTMAVVAIHFLLPIAVVSFCYLRIWILVLQARRKAKAERKL
RLRPSDLRSFLTMFAVFVVFAICWAPLNCIGLAVAINPEAMALQIPEGLFVTSYFLAYFN
SCLNAIVYGLLNQNFRREYKRILSALWSTGRCFHDASKCHLTEDLQGPVPPAAMATIPVQ
EGAL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50149169
NameBDBM50149169
Synonyms:CHEMBL127570 | Cyclopropanecarboxylic acid [3-(2-methyl-benzooxazol-7-yl)-propyl]-amide
TypeSmall organic molecule
Emp. Form.C15H18N2O2
Mol. Mass.258.3156
SMILESCc1nc2cccc(CCCNC(=O)C3CC3)c2o1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a