Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 3 (LPAR3)
LigandBDBM50146230
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304755
Ki 940±n/a nM
Citation Heasley, BHJarosz, RCarter, KMVan, SJLynch, KRMacdonald, TL A novel series of 2-pyridyl-containing compounds as lysophosphatidic acid receptor antagonists: development of a nonhydrolyzable LPA3 receptor-selective antagonist. Bioorg Med Chem Lett14:4069-74 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 3 (LPAR3)
Name:Lysophosphatidic acid receptor 1/3
Synonyms:Lysophosphatidic acid receptor Edg-7
Type:Enzyme
Mol. Mass.:40149.72
Organism:Homo sapiens (Human)
Description:Q9UBY5
Residue:353
Sequence:
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50146230
NameBDBM50146230
Synonyms:CHEMBL314555 | Phosphoric acid mono-{(S)-2-((Z)-octadec-9-enoylamino)-3-[4-(pyridin-2-ylmethoxy)-phenyl]-propyl} ester | Phosphoric acid mono-{2-((Z)-(S)-octadec-9-enoylamino)-3-[4-(pyridin-2-ylmethoxy)-phenyl]-propyl} ester
TypeSmall organic molecule
Emp. Form.C33H51N2O6P
Mol. Mass.602.7416
SMILESCCCCCCCC\C=C/CCCCCCCC(=O)N[C@H](COP(O)(O)=O)Cc1ccc(OCc2ccccn2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a