Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetLysophosphatidic acid receptor 3 (LPAR3)
LigandBDBM50150004
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304755
Ki 1050±n/a nM
Citation Heasley, BHJarosz, RCarter, KMVan, SJLynch, KRMacdonald, TL A novel series of 2-pyridyl-containing compounds as lysophosphatidic acid receptor antagonists: development of a nonhydrolyzable LPA3 receptor-selective antagonist. Bioorg Med Chem Lett14:4069-74 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Lysophosphatidic acid receptor 3 (LPAR3)
Name:Lysophosphatidic acid receptor 1/3
Synonyms:Lysophosphatidic acid receptor Edg-7
Type:Enzyme
Mol. Mass.:40149.72
Organism:Homo sapiens (Human)
Description:Q9UBY5
Residue:353
Sequence:
MNECHYDKHMDFFYNRSNTDTVDDWTGTKLVIVLCVGTFFCLFIFFSNSLVIAAVIKNRK
FHFPFYYLLANLAAADFFAGIAYVFLMFNTGPVSKTLTVNRWFLRQGLLDSSLTASLTNL
LVIAVERHMSIMRMRVHSNLTKKRVTLLILLVWAIAIFMGAVPTLGWNCLCNISACSSLA
PIYSRSYLVFWTVSNLMAFLIMVVVYLRIYVYVKRKTNVLSPHTSGSISRRRTPMKLMKT
VMTVLGAFVVCWTPGLVVLLLDGLNCRQCGVQHVKRWFLLLALLNSVVNPIIYSYKDEDM
YGTMKKMICCFSQENPERRPSRIPSTVLSRSDTGSQYIEDSISQGAVCNKSTS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50150004
NameBDBM50150004
Synonyms:CHEMBL360064 | {(S)-3-Hexadecanoylamino-4-[4-(pyridin-2-ylmethoxy)-phenyl]-butyl}-phosphonic acid
TypeSmall organic molecule
Emp. Form.C32H51N2O5P
Mol. Mass.574.7315
SMILESCCCCCCCCCCCCCCCC(=O)N[C@H](CCP(O)(O)=O)Cc1ccc(OCc2ccccn2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a