Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMetabotropic glutamate receptor 6 (mGlu6)
LigandBDBM50151435
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306010
IC50 2060±n/a nM
Citation Nakazato, ASakagami, KYasuhara, AOhta, HYoshikawa, RItoh, MNakamura, MChaki, S Synthesis, in vitro pharmacology, structure-activity relationships, and pharmacokinetics of 3-alkoxy-2-amino-6-fluorobicyclo[3.1.0]hexane-2,6-dicarboxylic acid derivatives as potent and selective group II metabotropic glutamate receptor antagonists. J Med Chem47:4570-87 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Metabotropic glutamate receptor 6 (mGlu6)
Name:Metabotropic glutamate receptor 6 (mGlu6)
Synonyms:GRM6 | mGlu6 | mGluR6 | metabotropic glutamate 6
Type:Enzyme
Mol. Mass.:95095.82
Organism:Rattus norvegicus (Rat)
Description:P35349
Residue:871
Sequence:
MGRLPVLLLWLAWWLSQAGIACGAGSVRLAGGLTLGGLFPVHARGAAGRACGALKKEQGV
HRLEAMLYALDRVNADPELLPGVRLGARLLDTCSRDTYALEQALSFVQALIRGRGDGDEA
SVRCPGGVPPLRSAPPERVVAVVGASASSVSIMVANVLRLFAIPQISYASTAPELSDSTR
YDFFSRVVPPDSYQAQAMVDIVRALGWNYVSTLASEGNYGESGVEAFVQISREAGGVCIA
QSIKIPREPKPGEFHKVIRRLMETPNARGIIIFANEDDIRRVLEATRQANLTGHFLWVGS
DSWGSKISPILNLEEEAVGAITILPKRASIDGFDQYFMTRSLENNRRNIWFAEFWEENFN
CKLTSSGGQSDDSTRKCTGEERIGQDSAYEQEGKVQFVIDAVYAIAHALHSMHQALCPGH
TGLCPAMEPTDGRTLLHYIRAVRFNGSAGTPVMFNENGDAPGRYDIFQYQATNGSASSGG
YQAVGQWAEALRLDMEVLRWSGDPHEVPPSQCSLPCGPGERKKMVKGVPCCWHCEACDGY
RFQVDEFTCEACPGDMRPTPNHTGCRPTPVVRLTWSSPWAALPLLLAVLGIMATTTIMAT
FMRHNDTPIVRASGRELSYVLLTGIFLIYAITFLMVAEPCAAICAARRLLLGLGTTLSYS
ALLTKTNRIYRIFEQGKRSVTPPPFISPTSQLVITFGLTSLQVVGVIAWLGAQPPHSVID
YEEQRTVDPEQARGVLKCDMSDLSLIGCLGYSLLLMVTCTVYAIKARGVPETFNEAKPIG
FTMYTTCIIWLAFVPIFFGTAQSAEKIYIQTTTLTVSLSLSASVSLGMLYVPKTYVILFH
PEQNVQKRKRSLKKTSTMAAPPQNENAEDAK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50151435
NameBDBM50151435
Synonyms:(1R,2R,3R,5R,6R)-2-Amino-3-(3,4-dichloro-benzyloxy)-6-fluoro-bicyclo[3.1.0]hexane-2,6-dicarboxylic acid | CHEMBL186453
TypeSmall organic molecule
Emp. Form.C15H14Cl2FNO5
Mol. Mass.378.18
SMILESN[C@@]1([C@H]2[C@@H](C[C@H]1OCc1ccc(Cl)c(Cl)c1)[C@]2(F)C(O)=O)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a