Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSerotonin (5-HT) receptor
LigandBDBM50151976
Substrate/Competitorn/a
Meas. Tech.ChEBML_306314
IC50 0.070000±n/a nM
Citation Heinrich, TBöttcher, HBartoszyk, GDGreiner, HESeyfried, CAVan Amsterdam, C Indolebutylamines as selective 5-HT(1A) agonists. J Med Chem47:4677-83 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Serotonin (5-HT) receptor
Name:Serotonin 1 (5-HT1) receptor
Synonyms:5-HT-1A | 5-HT1 | 5-HT1A | 5-Hydroxytryptamine receptor 1A (5-HT1A) | 5-hydroxytryptamine receptor 1A | 5-hydroxytryptamine receptor 1A (5HT1A) | G-21 | Serotonin 1a (5-HT1a) receptor/Adrenergic receptor alpha-1 | Serotonin receptor 1A
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:46445.29
Organism:Rattus norvegicus (rat)
Description:Binding assays were performed using rat hippocampal membranes.
Residue:422
Sequence:
MDVFSFGQGNNTTASQEPFGTGGNVTSISDVTFSYQVITSLLLGTLIFCAVLGNACVVAA
IALERSLQNVANYLIGSLAVTDLMVSVLVLPMAALYQVLNKWTLGQVTCDLFIALDVLCC
TSSILHLCAIALDRYWAITDPIDYVNKRTPRRAAALISLTWLIGFLISIPPMLGWRTPED
RSDPDACTISKDHGYTIYSTFGAFYIPLLLMLVLYGRIFRAARFRIRKTVRKVEKKGAGT
SLGTSSAPPPKKSLNGQPGSGDWRRCAENRAVGTPCTNGAVRQGDDEATLEVIEVHRVGN
SKEHLPLPSESGSNSYAPACLERKNERNAEAKRKMALARERKTVKTLGIIMGTFILCWLP
FFIVALVLPFCESSCHMPALLGAIINWLGYSNSLLNPVIYAYFNKDFQNAFKKIIKCKFC
RR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50151976
NameBDBM50151976
Synonyms:3-{4-[4-(2,4-Dimethoxy-phenyl)-piperazin-1-yl]-butyl}-1H-indole-5-carboxylic acid amide | CHEMBL364181
TypeSmall organic molecule
Emp. Form.C25H32N4O3
Mol. Mass.436.5466
SMILESCOc1ccc(N2CCN(CCCCc3c[nH]c4ccc(cc34)C(N)=O)CC2)c(OC)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a