Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetSodium/glucose cotransporter 1 (SGLT1)
LigandBDBM50153308
Substrate/Competitorn/a
Meas. Tech.ChEMBL_308699
Ki 9890.0±n/a nM
Citation Dudash, JZhang, XZeck, REJohnson, SGCox, GGConway, BRRybczynski, PJDemarest, KT Glycosylated dihydrochalcones as potent and selective sodium glucose co-transporter 2 (SGLT2) inhibitors. Bioorg Med Chem Lett14:5121-5 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Sodium/glucose cotransporter 1 (SGLT1)
Name:Sodium/glucose cotransporter 1 (SGLT1)
Synonyms:High affinity sodium-glucose cotransporter | Na(+)/glucose cotransporter 1 | Sodium-Dependent Glucose Cotransporter 1 (SGLT1) | Sodium-dependent glucose cotransporter 1 (SGLT1) | Solute carrier family 5 member 1
Type:Protein
Mol. Mass.:73503.78
Organism:Homo sapiens (Human)
Description:P13866
Residue:664
Sequence:
MDSSTWSPKTTAVTRPVETHELIRNAADISIIVIYFVVVMAVGLWAMFSTNRGTVGGFFL
AGRSMVWWPIGASLFASNIGSGHFVGLAGTGAASGIAIGGFEWNALVLVVVLGWLFVPIY
IKAGVVTMPEYLRKRFGGQRIQVYLSLLSLLLYIFTKISADIFSGAIFINLALGLNLYLA
IFLLLAITALYTITGGLAAVIYTDTLQTVIMLVGSLILTGFAFHEVGGYDAFMEKYMKAI
PTIVSDGNTTFQEKCYTPRADSFHIFRDPLTGDLPWPGFIFGMSILTLWYWCTDQVIVQR
CLSAKNMSHVKGGCILCGYLKLMPMFIMVMPGMISRILYTEKIACVVPSECEKYCGTKVG
CTNIAYPTLVVELMPNGLRGLMLSVMLASLMSSLTSIFNSASTLFTMDIYAKVRKRASEK
ELMIAGRLFILVLIGISIAWVPIVQSAQSGQLFDYIQSITSYLGPPIAAVFLLAIFWKRV
NEPGAFWGLILGLLIGISRMITEFAYGTGSCMEPSNCPTIICGVHYLYFAIILFAISFIT
IVVISLLTKPIPDVHLYRLCWSLRNSKEERIDLDAEEENIQEGPKETIEIETQVPEKKKG
IFRRAYDLFCGLEQHGAPKMTEEEEKAMKMKMTDTSEKPLWRTVLNVNGIILVTVAVFCH
AYFA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50153308
NameBDBM50153308
Synonyms:1-[2-Amino-4-methyl-6-(3,4,5-trihydroxy-6-hydroxymethyl-tetrahydro-pyran-2-yloxy)-phenyl]-3-naphthalen-2-yl-propan-1-one | CHEMBL361672
TypeSmall organic molecule
Emp. Form.C26H29NO7
Mol. Mass.467.511
SMILESCc1cc(N)c(C(=O)CCc2ccc3ccccc3c2)c(O[C@@H]2O[C@H](CO)[C@@H](O)[C@H](O)[C@H]2O)c1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a