Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase TEC
LigandBDBM14320
Substrate/Competitorn/a
Meas. Tech.ChEMBL_302256
Kd 650000±n/a nM
Citation Inglis, SRStojkoski, CBranson, KMCawthray, JFFritz, DWiadrowski, EPyke, SMBooker, GW Identification and specificity studies of small-molecule ligands for SH3 protein domains. J Med Chem47:5405-17 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase TEC
Name:Tyrosine-protein kinase TEC
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:71010.89
Organism:Mus musculus
Description:ChEMBL_304473
Residue:608
Sequence:
MNFNTILEEILIKRSQQKKKTSPLNYKERLFVLTKSVLSYYEGRAEKKYRKGVIDISKIK
CVEIVKNDDGVIPCQNKFPFQVVHDANTLYIFAPSPQSRDRWVKKLKEEIKNNNNIMIKY
HPKFWADGSYQCCRQTEKLAPGCEKYNLFESSIRKTLPPAPEIKKRRPPPPIPPEEENTE
EIVVAMYDFQATEAHDLRLERGQEYIILEKNDLHWWRARDKYGWYCRNTNRSKAEQLLRT
EDKEGGFMVRDSSQPGLYTVSLYTKFGGEGSSGFRHYHIKETATSPKKYYLAEKHAFGSI
PEIIEYHKHNAAGLVTRLRYPVSTKGKNAPTTAGFSYDKWEINPSELTFMRELGSGLFGV
VRLGKWRAQYKVAIKAIREGAMCEEDFIEEAKVMMKLTHPKLVQLYGVCTQQKPIYIVTE
FMERGCLLNFLRQRQGHFSRDMLLSMCQDVCEGMEYLERNSFIHRDLAARNCLVNEAGVV
KVSDFGMARYVLDDQYTSSSGAKFPVKWCPPEVFNYSRFSSKSDVWSFGVLMWEIFTEGR
MPFEKNTNYEVVTMVTRGHRLHRPKLASKYLYEVMLRCWQERPEGRPSFEDLLRTIDELV
ECEETFGR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM14320
NameBDBM14320
Synonyms:1-amino-isoquinoline | CHEMBL62083 | Fragment 17 | fragment 1 (J. med. chem.,50,1116) | isoquinolin-1-amine
TypeSmall organic molecule
Emp. Form.C9H8N2
Mol. Mass.144.1732
SMILESNc1nccc2ccccc12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a