Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyrotropin-releasing hormone receptor
LigandBDBM50156179
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303571
Ki>10000±n/a nM
Citation Prokai, LProkai-Tatrai, KZharikova, ADNguyen, VPerjesi, PStevens, SM Centrally acting and metabolically stable thyrotropin-releasing hormone analogues by replacement of histidine with substituted pyridinium. J Med Chem47:6025-33 (2004) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thyrotropin-releasing hormone receptor
Name:Thyrotropin-releasing hormone receptor
Synonyms:TRH-R | Thyroliberin receptor
Type:PROTEIN
Mol. Mass.:46618.79
Organism:Rattus norvegicus
Description:ChEMBL_303571
Residue:412
Sequence:
MENETVSELNQTELPPQVAVALEYQVVTILLVVVICGLGIVGNIMVVLVVMRTKHMRTAT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVISCG
YKISRNYYSPIYLMDFGVFYVMPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH
QNKNMNLNTTNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKAANYSVALNYSVIKES
DRFSTELDDITVTDTYVSTTKVSFDDTCLASEKNGPSSCTYGYSLTAKQEKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50156179
NameBDBM50156179
Synonyms:3-carbamoyl-1-{4-(2-carbamoyl-pyrrolidin-1-yl)-4-oxo-3-[(5-oxo-pyrrolidine-2-carbonyl)-amino]-butyl}-pyridinium; | CHEMBL362358
TypeSmall organic molecule
Emp. Form.C20H27N6O5
Mol. Mass.431.465
SMILESNC(=O)C1CCCN1C(=O)C(CC[n+]1cccc(c1)C(N)=O)NC(=O)C1CCC(=O)N1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a