Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetC-X-C chemokine receptor type 4 (CXCR4)
LigandBDBM50159213
Substrate/Competitorn/a
Meas. Tech.ChEMBL_306161
IC50 4.5±n/a nM
Citation Tamamura, HHiramatsu, KUeda, SWang, ZKusano, STerakubo, STrent, JOPeiper, SCYamamoto, NNakashima, HOtaka, AFujii, N Stereoselective synthesis of [L-Arg-L/D-3-(2-naphthyl)alanine]-type (E)-alkene dipeptide isosteres and its application to the synthesis and biological evaluation of pseudopeptide analogues of the CXCR4 antagonist FC131. J Med Chem48:380-91 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
C-X-C chemokine receptor type 4 (CXCR4)
Name:C-X-C chemokine receptor type 4
Synonyms:C-X-C chemokine receptor type 4 | CD_antigen=CD184 | CXC-R4 | CXCR-4 | FB22 | Fusin | HM89 | LCR1 | LESTR | Leukocyte-derived seven transmembrane domain receptor | NPYRL | SDF-1 receptor | Stromal cell-derived factor 1 receptor
Type:Enzyme
Mol. Mass.:39754.61
Organism:Homo sapiens (Human)
Description:P61073
Residue:352
Sequence:
MEGISIYTSDNYTEEMGSGDYDSMKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50159213
NameBDBM50159213
Synonyms:CHEMBL370001 | N-{3-[10-(3-Guanidino-propyl)-4-(4-hydroxy-benzyl)-13-naphthalen-2-ylmethyl-2,5,8,11,14-pentaoxo-1,3,6,9,12pentaaza-cyclotetradec-7-yl]-propyl}-guanidine | N-{3-[5-(3-Guanidino-propyl)-11-(4-hydroxy-benzyl)-2-naphthalen-2-ylmethyl-4,7,10,13,14-pentaoxo-1,3,6,9,12pentaaza-cyclotetradec-8-yl]-propyl}-guanidine
TypeSmall organic molecule
Emp. Form.C35H45N11O6
Mol. Mass.715.8019
SMILESNC(=N)NCCC[C@@H]1NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](Cc2ccc(O)cc2)NC(=O)NC(=O)[C@H](Cc2ccc3ccccc3c2)NC1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a