Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM50162859
Substrate/Competitorn/a
Meas. Tech.ChEMBL_305278
IC50 100±n/a nM
Citation Clark, RDJahangir, AAlam, MRocha, CLin, LBjorner, BNguyen, KGrady, CWilliams, TJStepan, GTang, HMFord, AP Identification of a 5-HT4 receptor antagonist clinical candidate through side-chain modification. Bioorg Med Chem Lett15:1697-700 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:HISTAMINE H1
Type:Enzyme Catalytic Domain
Mol. Mass.:55716.35
Organism:RAT
Description:HISTAMINE H1 HRH1 RAT::P31390
Residue:486
Sequence:
MSFANTSSTFEDKMCEGNRTAMASPQLLPLVVVLSSISLVTVGLNLLVLYAVHSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLIMTKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLRYRTKTRASATILGAWFFSFLWVIPILGWHHFMPPAPELREDKC
ETDFYNVTWFKIMTAIINFYLPTLLMLWFYVKIYKAVRRHCQHRQLTNGSLPSFSELKLR
SDDTKEGAKKPGRESPWGVLKRPSRDPSVGLDQKSTSEDPKMTSPTVFSQEGERETRPCF
RLDIMQKQSVAEGDVRGSKANDQALSQPKMDEQSLNTCRRISETSEDQTLVDQQSFSRTT
DSDTSIEPGPGRVKSRSGSNSGLDYIKITWKRLRSHSRQYVSGLHLNRERKAAKQLGFIM
AAFILCWIPYFIFFMVIAFCKSCCSEPMHMFTIWLGYINSTLNPLIYPLCNENFKKTFKK
ILHIRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50162859
NameBDBM50162859
Synonyms:2,3-Dihydro-benzo[1,4]dioxine-5-carboxylic acid {1-[3-(4-methyl-piperazine-1-sulfonyl)-propyl]-piperidin-4-ylmethyl}-amide | CHEMBL180632
TypeSmall organic molecule
Emp. Form.C23H36N4O5S
Mol. Mass.480.621
SMILESCN1CCN(CC1)S(=O)(=O)CCCN1CCC(CNC(=O)c2cccc3OCCOc23)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a