Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMelanocortin receptor 3 (MC3R)
LigandBDBM50165926
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303606
Ki 7.9±n/a nM
Citation Mayer, JPHsiung, HMFlora, DBEdwards, PSmith, DPZhang, XYGadski, RAHeiman, MLHertel, JLEmmerson, PJHusain, SO'brien, TPKahl, SDSmiley, DLZhang, LDimarchi, RDYan, LZ Discovery of a beta-MSH-derived MC-4R selective agonist. J Med Chem48:3095-8 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Melanocortin receptor 3 (MC3R)
Name:Melanocortin receptor (M3 and M4)
Synonyms:MC3-R | MC3R | Melanocortin MC3 | Melanocortin receptor (M3 and M4) | Melanocortin receptor 3
Type:Enzyme
Mol. Mass.:36044.86
Organism:Homo sapiens (Human)
Description:P41968
Residue:323
Sequence:
MNASCCLPSVQPTLPNGSEHLQAPFFSNQSSSAFCEQVFIKPEVFLSLGIVSLLENILVI
LAVVRNGNLHSPMYFFLCSLAVADMLVSVSNALETIMIAIVHSDYLTFEDQFIQHMDNIF
DSMICISLVASICNLLAIAVDRYVTIFYALRYHSIMTVRKALTLIVAIWVCCGVCGVVFI
VYSESKMVIVCLITMFFAMMLLMGTLYVHMFLFARLHVKRIAALPPADGVAPQQHSCMKG
AVTITILLGVFIFCWAPFFLHLVLIITCPTNPYCICYTAHFNTYLVLIMCNSVIDPLIYA
FRSLELRNTFREILCGCNGMNLG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50165926
NameBDBM50165926
Synonyms:Ac-YR[CEHdFRWC]SPPKD-NH2 | CHEMBL2373515
TypeSmall organic molecule
Emp. Form.C83H115N25O21S2
Mol. Mass.1863.086
SMILESCC(=O)N[C@@H](Cc1ccc(O)cc1)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N[C@@H]1CSSC[C@@H](NC(=O)[C@@H](Cc2c[nH]c3ccccc23)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](Cc2ccccc2)NC(=O)[C@H](Cc2c[nH]cn2)NC(=O)[C@@H](CCC(O)=O)NC1=O)C(=O)N[C@@H](CO)C(=O)N1CCC[C@H]1C(=O)N1CCC[C@H]1C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(O)=O)C(N)=O |wU:103.110,32.96,27.27,4.3,72.76,114.121,61.64,50.53,wD:110.118,94.99,16.16,123.130,36.37,82.87,(-1.2,-14.32,;-.65,-12.88,;.87,-12.64,;-1.63,-11.7,;-1.07,-10.25,;-2.62,-10.24,;-3.96,-9.47,;-5.2,-10.39,;-6.61,-9.78,;-6.79,-8.24,;-8.2,-7.63,;-5.55,-7.32,;-4.14,-7.93,;.45,-10.01,;1.41,-11.19,;.99,-8.56,;.02,-7.37,;1.51,-6.97,;3.03,-6.87,;3.9,-8.14,;5.44,-8.04,;6.29,-9.31,;7.83,-9.22,;5.61,-10.7,;-1.49,-7.62,;-2.04,-9.06,;-2.48,-6.43,;-1.91,-4.99,;-.42,-5.33,;1.11,-5.27,;2.58,-4.78,;3.85,-3.92,;4.85,-2.75,;5.49,-1.36,;5.74,.16,;7.28,.13,;5.56,1.69,;7.06,2.08,;8.14,3.18,;9.06,4.42,;10.51,3.93,;10.5,2.38,;11.63,1.35,;11.28,-.15,;9.82,-.62,;8.7,.44,;9.03,1.94,;4.98,3.11,;4.04,4.33,;5.12,5.43,;2.81,5.24,;3.54,6.6,;5.09,6.63,;5.82,7.98,;7.36,8,;8.1,9.36,;9.64,9.4,;7.3,10.67,;1.37,5.79,;-.16,5.95,;-.23,7.47,;-1.68,5.67,;-2.16,7.12,;-1.14,8.26,;.38,7.93,;1.39,9.08,;.91,10.56,;-.6,10.86,;-1.62,9.71,;-3.06,4.97,;-4.21,3.95,;-5.38,4.96,;-5.04,2.66,;-6.44,3.31,;-6.58,4.84,;-5.42,5.85,;-6.02,7.26,;-7.56,7.12,;-7.89,5.62,;-5.48,1.19,;-5.52,-.35,;-7.05,-.52,;-5.13,-1.84,;-6.56,-2.42,;-7.8,-1.48,;-9.21,-2.06,;-10.42,-1.11,;-9.42,-3.59,;-4.38,-3.17,;-3.27,-4.25,;-4.19,-5.49,;6.15,-3.59,;6.08,-5.12,;7.51,-2.88,;8.81,-3.7,;8.73,-5.24,;10.04,-6.07,;10.17,-3,;10.25,-1.46,;11.47,-3.71,;10.78,-2.02,;11.57,-.8,;12.9,-1.58,;12.83,-3.12,;14.14,-3.95,;14.07,-5.49,;15.34,-3.36,;14.94,-4.86,;15.22,-6.01,;16.72,-5.61,;16.79,-4.06,;18.17,-3.36,;18.22,-1.83,;19.46,-4.2,;20.82,-3.48,;20.9,-1.95,;22.25,-1.24,;22.33,.3,;23.7,1,;23.77,2.55,;22.11,-4.31,;22.04,-5.85,;23.49,-3.61,;24.79,-4.43,;24.71,-5.98,;26.01,-6.8,;27.51,-7.2,;25.94,-8.33,;26.15,-3.73,;27.45,-4.56,;26.22,-2.19,)|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a