Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetmineralocorticoid
LigandBDBM50167799
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304692
IC50 7400±n/a nM
Citation Smith, CJAli, ABalkovec, JMGraham, DWHammond, MLPatel, GFRouen, GPSmith, SKTata, JREinstein, MGe, LHarris, GSKelly, TMMazur, PThompson, CMWang, CFWilliamson, JMMiller, DKPandit, SSantoro, JCSitlani, AYamin, TTO'Neill, EAZaller, DMCarballo-Jane, EForrest, MJLuell, S Novel ketal ligands for the glucocorticoid receptor: in vitro and in vivo activity. Bioorg Med Chem Lett15:2926-31 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
mineralocorticoid
Name:mineralocorticoid
Synonyms:MR | Mineralocorticoid Receptor (MR) | Mineralocorticoid receptor | Nuclear receptor subfamily 3 group C member 2
Type:Enzyme Catalytic Domain
Mol. Mass.:106748.15
Organism:RAT
Description:mineralocorticoid 0 RAT::P22199
Residue:981
Sequence:
METKGYHSLPEGLDMERRWSQVSQTLERSSLGPAERTTENNYMEIVNVSCVSGAIPNNST
QGSSKEKHELLPYIQQDNSRSGILPSDIKTELESKELSATVAESMGLYMDSVRDAEYTYD
QQNQQGSLSPTKIYQNMEQLVKFYKENGHRSSTLSAMSRPLRSFMPDSAASMNGGALRAI
VKSPIICHEKSSSVSSPLNMASSVCSPVGINSMSSSTTSFGSFPVHSPITQGTSLTCSPS
VENRGSRSHSPTHASNVGSPLSSPLSSMKSPISSPPSHCSVKSPVSSPNNVPLRSSVSSP
ANLNNSRCSVSSPSNNTNNRSTLSSPTASTVGSIGSPISNAFSYATSGASAGAGAIQDVV
PSPDTHEKGAHDVPFPKTEEVEKAISNGVTGPLNIVQYIKSEPDGAFSSSCLGGNSKISP
SSPFSVPIKQESSKHSCSGASFKGNPTVNPFPFMDGSYFSFMDDKDYYSLSGILGPPVPG
FDGSCEDSAFPVGIKQEPDDGSYYPEASIPSSAIVGVNSGGQSFHYRIGAQGTISLSRSP
RDQSFQHLSSFPPVNTLVESWKPHGDLSSRRSDGYPVLEYIPENVSSSTLRSVSTGSSRP
SKICLVCGDEASGCHYGVVTCGSCKVFFKRAVEGQHNYLCAGRNDCIIDKIRRKNCPACR
LQKCLQAGMNLGARKSKKLGKLKGLHEEQPQQPPPPPPQSPEEGTTYIAPTKEPSVNSAL
VPQLTSITHALTPSPAMILENIEPETVYAGYDNSKPDTAESLLSTLNRLAAKQMIQVVKW
AKVLPGFKNLPLEDQITLIQYSWMCLSSFALSWRSYKHTNSQLLYFAPDLVFNEEKMHQS
AMYELCQGMRQISLQFVRLQLTFEEYSIMKVLLLLSTVPKDGLKSQAAFEEMRTNYIKEL
RKMVTKCPNSSGQSWQRFYQLTKLLDSMHDLVSDLLEFCFYTFRESQALKVEFPAMLVEI
ITDQLPKVESGNAKPLYFHRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50167799
NameBDBM50167799
Synonyms:1-(4-fluorophenyl)-4a-methyl-4',5'-divinyl-(4'R,4aS,5'R)-spiro[4,4a,5,6,7,8-hexahydro-1H-benzo[f]indazole-5,2'-(dihydro[1,3]dioxolane)] | CHEMBL382102
TypeSmall organic molecule
Emp. Form.C24H25FN2O2
Mol. Mass.392.4659
SMILESC[C@]12Cc3cnn(c3C=C1CCCC21O[C@H](C=C)[C@H](O1)C=C)-c1ccc(F)cc1 |c:9|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a