Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetDipeptidyl peptidase VIII
LigandBDBM11694
Substrate/Competitorn/a
Meas. Tech.ChEMBL_304640
IC50 27±n/a nM
Citation Lu, ILLee, SJTsu, HWu, SYKao, KHChien, CHChang, YYChen, YSCheng, JHChang, CNChen, TWChang, SPChen, XJiaang, WT Glutamic acid analogues as potent dipeptidyl peptidase IV and 8 inhibitors. Bioorg Med Chem Lett15:3271-5 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Dipeptidyl peptidase VIII
Name:Dipeptidyl peptidase VIII
Synonyms:DPP8 | DPRP-1 | Dipeptidyl peptidase 8 (DPP-8) | Dipeptidyl peptidase 8 (DPP8) | Dipeptidyl peptidase IV-related protein 1 | Dipeptidyl peptidase VIII (DDP-VIII) | Prolyl dipeptidase DPP8
Type:Enzyme
Mol. Mass.:103342.62
Organism:Homo sapiens (Human)
Description:Q6V1X1
Residue:898
Sequence:
MWKRSEQMKIKSGKCNMAAAMETEQLGVEIFETADCEENIESQDRPKLEPFYVERYSWSQ
LKKLLADTRKYHGYMMAKAPHDFMFVKRNDPDGPHSDRIYYLAMSGENRENTLFYSEIPK
TINRAAVLMLSWKPLLDLFQATLDYGMYSREEELLRERKRIGTVGIASYDYHQGSGTFLF
QAGSGIYHVKDGGPQGFTQQPLRPNLVETSCPNIRMDPKLCPADPDWIAFIHSNDIWISN
IVTREERRLTYVHNELANMEEDARSAGVATFVLQEEFDRYSGYWWCPKAETTPSGGKILR
ILYEENDESEVEIIHVTSPMLETRRADSFRYPKTGTANPKVTFKMSEIMIDAEGRIIDVI
DKELIQPFEILFEGVEYIARAGWTPEGKYAWSILLDRSQTRLQIVLISPELFIPVEDDVM
ERQRLIESVPDSVTPLIIYEETTDIWINIHDIFHVFPQSHEEEIEFIFASECKTGFRHLY
KITSILKESKYKRSSGGLPAPSDFKCPIKEEIAITSGEWEVLGRHGSNIQVDEVRRLVYF
EGTKDSPLEHHLYVVSYVNPGEVTRLTDRGYSHSCCISQHCDFFISKYSNQKNPHCVSLY
KLSSPEDDPTCKTKEFWATILDSAGPLPDYTPPEIFSFESTTGFTLYGMLYKPHDLQPGK
KYPTVLFIYGGPQVQLVNNRFKGVKYFRLNTLASLGYVVVVIDNRGSCHRGLKFEGAFKY
KMGQIEIDDQVEGLQYLASRYDFIDLDRVGIHGWSYGGYLSLMALMQRSDIFRVAIAGAP
VTLWIFYDTGYTERYMGHPDQNEQGYYLGSVAMQAEKFPSEPNRLLLLHGFLDENVHFAH
TSILLSFLVRAGKPYDLQIYPQERHSIRVPESGEHYELHLLHYLQENLGSRIAALKVI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM11694
NameBDBM11694
Synonyms:(2S)-1-[(2S)-2-amino-2-cyclohexylacetyl]pyrrolidine-2-carbonitrile | BMCL15687 Compound 3 | CHEMBL307636 | Cyclohexylglycine-(2S)-cyanopyrolidine 3 | Cyclohexylglycine-(2S)-cyanopyrrolidine 2
TypeSmall organic molecule
Emp. Form.C13H21N3O
Mol. Mass.235.3253
SMILESN[C@@H](C1CCCCC1)C(=O)N1CCC[C@H]1C#N |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a