Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast activation protein alpha
LigandBDBM50171552
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321439
IC50 11±n/a nM
Citation Shreder, KRWong, MSCorral, SYu, ZWinn, DTWu, MHu, YNomanbhoy, TAlemayehu, SFuller, SRRosenblum, JSKozarich, JW Boro-norleucine as a P1 residue for the design of selective and potent DPP7 inhibitors. Bioorg Med Chem Lett15:4256-60 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibroblast activation protein alpha
Name:Fibroblast activation protein alpha
Synonyms:170 kDa melanoma membrane-bound gelatinase | Integral membrane serine protease | Seprase
Type:Enzyme
Mol. Mass.:87712.48
Organism:Homo sapiens (Human)
Description:Q12884
Residue:760
Sequence:
MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPN
WISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSK
LWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPP
FQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYG
DEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVT
DERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYD
AISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGR
TDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQV
YGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQ
ITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVY
TERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNA
QVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50171552
NameBDBM50171552
Synonyms:(S)-2-(S)-Amino-1-(2-boron-dihydroxide-pyrrolidine)-3-methyl-butan-1-one | CHEMBL195189
TypeSmall organic molecule
Emp. Form.C9H19BN2O3
Mol. Mass.214.07
SMILESCC(C)[C@H](N)C(=O)N1CCC[C@@H]1B(O)O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a