Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast activation protein alpha
LigandBDBM50171657
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321506
IC50 180±n/a nM
Citation Hu, YMa, LWu, MWong, MSLi, BCorral, SYu, ZNomanbhoy, TAlemayehu, SFuller, SRRosenblum, JSRozenkrants, NMinimo, LCRipka, WCSzardenings, AKKozarich, JWShreder, KR Synthesis and structure-activity relationship of N-alkyl Gly-boro-Pro inhibitors of DPP4, FAP, and DPP7. Bioorg Med Chem Lett15:4239-42 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Fibroblast activation protein alpha
Name:Fibroblast activation protein alpha
Synonyms:170 kDa melanoma membrane-bound gelatinase | Integral membrane serine protease | Seprase
Type:Enzyme
Mol. Mass.:87712.48
Organism:Homo sapiens (Human)
Description:Q12884
Residue:760
Sequence:
MKTWVKIVFGVATSAVLALLVMCIVLRPSRVHNSEENTMRALTLKDILNGTFSYKTFFPN
WISGQEYLHQSADNNIVLYNIETGQSYTILSNRTMKSVNASNYGLSPDRQFVYLESDYSK
LWRYSYTATYYIYDLSNGEFVRGNELPRPIQYLCWSPVGSKLAYVYQNNIYLKQRPGDPP
FQITFNGRENKIFNGIPDWVYEEEMLATKYALWWSPNGKFLAYAEFNDTDIPVIAYSYYG
DEQYPRTINIPYPKAGAKNPVVRIFIIDTTYPAYVGPQEVPVPAMIASSDYYFSWLTWVT
DERVCLQWLKRVQNVSVLSICDFREDWQTWDCPKTQEHIEESRTGWAGGFFVSTPVFSYD
AISYYKIFSDKDGYKHIHYIKDTVENAIQITSGKWEAINIFRVTQDSLFYSSNEFEEYPG
RRNIYRISIGSYPPSKKCVTCHLRKERCQYYTASFSDYAKYYALVCYGPGIPISTLHDGR
TDQEIKILEENKELENALKNIQLPKEEIKKLEVDEITLWYKMILPPQFDRSKKYPLLIQV
YGGPCSQSVRSVFAVNWISYLASKEGMVIALVDGRGTAFQGDKLLYAVYRKLGVYEVEDQ
ITAVRKFIEMGFIDEKRIAIWGWSYGGYVSSLALASGTGLFKCGIAVAPVSSWEYYASVY
TERFMGLPTKDDNLEHYKNSTVMARAEYFRNVDYLLIHGTADDNVHFQNSAQIAKALVNA
QVDFQAMWYSDQNHGLSGLSTNHLYTHMTHFLKQCFSLSD
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50171657
NameBDBM50171657
Synonyms:2-(Bicyclo[3.2.1]oct-6-ylamino)-1-((S)-2-dihydroxymethyl-pyrrolidin-1-yl)-ethanone | CHEMBL362922
TypeSmall organic molecule
Emp. Form.C15H26N2O3
Mol. Mass.282.3785
SMILESOC(O)[C@@H]1CCCN1C(=O)CNC1CC2CC1CCC2 |TLB:11:12:15:17.18.19|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a