Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAcyl-CoA: cholesterol acyltransferase (ACAT)
LigandBDBM50171925
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303802
Ki 2.2±n/a nM
Citation Hyatt, JLStacy, VWadkins, RMYoon, KJWierdl, MEdwards, CCZeller, MHunter, ADDanks, MKCrundwell, GPotter, PM Inhibition of carboxylesterases by benzil (diphenylethane-1,2-dione) and heterocyclic analogues is dependent upon the aromaticity of the ring and the flexibility of the dione moiety. J Med Chem48:5543-50 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Acyl-CoA: cholesterol acyltransferase (ACAT)
Name:Acyl coenzyme A:cholesterol acyltransferase
Synonyms:Acyl coenzyme A:cholesterol acyltransferase | Serine hydrolase (CES1)
Type:Protein
Mol. Mass.:62520.83
Organism:Homo sapiens (Human)
Description:n/a
Residue:567
Sequence:
MWLRAFILATLSASAAWGHPSSPPVVDTVHGKVLGKFVSLEGFAQPVAIFLGIPFAKPPL
GPLRFTPPQPAEPWSFVKNATSYPPMCTQDPKAGQLLSELFTNRKENIPLKLSEDCLYLN
IYTPADLTKKNRLPVMVWIHGGGLMVGAASTYDGLALAAHENVVVVTIQYRLGIWGFFST
GDEHSRGNWGHLDQVAALRWVQDNIASFGGNPGSVTIFGESAGGESVSVLVLSPLAKNLF
HRAISESGVALTSVLVKKGDVKPLAEQIAITAGCKTTTSAVMVHCLRQKTEEELLETTLK
MKFLSLDLQGDPRESQPLLGTVIDGMLLLKTPEELQAERNFHTVPYMVGINKQEFGWLIP
MQLMSYPLSEGQLDQKTAMSLLWKSYPLVCIAKELIPEATEKYLGGTDDTVKKKDLFLDL
IADVMFGVPSVIVARNHRDAGAPTYMYEFQYRPSFSSDMKPKTVIGDHGDELFSVFGAPF
LKEGASEEEIRLSKMVMKFWANFARNGNPNGEGLPHWPEYNQKEGYLQIGANTQAAQKLK
DKEVAFWTNLFAKKAVEKPPQTEHIEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50171925
NameBDBM50171925
Synonyms:1,2-Bis-(4-bromo-thiophen-2-yl)-ethane-1,2-dione | 1,2-bis(4-bromothiophen-2-yl)ethane-1,2-dione | CHEMBL190672
TypeSmall organic molecule
Emp. Form.C10H4Br2O2S2
Mol. Mass.380.076
SMILESBrc1csc(c1)C(=O)C(=O)c1cc(Br)cs1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a