Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarboxylesterase 2
LigandBDBM50171921
Substrate/Competitorn/a
Meas. Tech.ChEMBL_303811
Ki 6540±n/a nM
Citation Hyatt, JLStacy, VWadkins, RMYoon, KJWierdl, MEdwards, CCZeller, MHunter, ADDanks, MKCrundwell, GPotter, PM Inhibition of carboxylesterases by benzil (diphenylethane-1,2-dione) and heterocyclic analogues is dependent upon the aromaticity of the ring and the flexibility of the dione moiety. J Med Chem48:5543-50 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Carboxylesterase 2
Name:Carboxylesterase 2
Synonyms:n/a
Type:PROTEIN
Mol. Mass.:61801.08
Organism:Homo sapiens (Human)
Description:ChEMBL_1494240
Residue:559
Sequence:
MRLHRLRARLSAVACGLLLLLVRGQGQDSASPIRTTHTGQVLGSLVHVKGANAGVQTFLG
IPFAKPPLGPLRFAPPEPPESWSGVRDGTTHPAMCLQDLTAVESEFLSQFNMTFPSDSMS
EDCLYLSIYTPAHSHEGSNLPVMVWIHGGALVFGMASLYDGSMLAALENVVVVIIQYRLG
VLGFFSTGDKHATGNWGYLDQVAALRWVQQNIAHFGGNPDRVTIFGESAGGTSVSSLVVS
PISQGLFHGAIMESGVALLPGLIASSADVISTVVANLSACDQVDSEALVGCLRGKSKEEI
LAINKPFKMIPGVVDGVFLPRHPQELLASADFQPVPSIVGVNNNEFGWLIPKVMRIYDTQ
KEMDREASQAALQKMLTLLMLPPTFGDLLREEYIGDNGDPQTLQAQFQEMMADSMFVIPA
LQVAHFQCSRAPVYFYEFQHQPSWLKNIRPPHMKADHGDELPFVFRSFFGGNYIKFTEEE
EQLSRKMMKYWANFARNGNPNGEGLPHWPLFDQEEQYLQLNLQPAVGRALKAHRLQFWKK
ALPQKIQELEEPEERHTEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50171921
NameBDBM50171921
Synonyms:1,2-Di-thiophen-3-yl-ethane-1,2-dione | 1,2-di(thiophen-3-yl)ethane-1,2-dione | CHEMBL372716
TypeSmall organic molecule
Emp. Form.C10H6O2S2
Mol. Mass.222.283
SMILESO=C(C(=O)c1ccsc1)c1ccsc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a