Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetThyrotropin-releasing hormone receptor
LigandBDBM50173821
Substrate/Competitorn/a
Meas. Tech.ChEMBL_321008
Ki>100000±n/a nM
Citation Kaur, NLu, XGershengorn, MCJain, R Thyrotropin-releasing hormone (TRH) analogues that exhibit selectivity to TRH receptor subtype 2. J Med Chem48:6162-5 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Thyrotropin-releasing hormone receptor
Name:Thyrotropin-releasing hormone receptor
Synonyms:TRH-R | Thyroliberin receptor
Type:PROTEIN
Mol. Mass.:46618.79
Organism:Rattus norvegicus
Description:ChEMBL_303571
Residue:412
Sequence:
MENETVSELNQTELPPQVAVALEYQVVTILLVVVICGLGIVGNIMVVLVVMRTKHMRTAT
NCYLVSLAVADLMVLVAAGLPNITDSIYGSWVYGYVGCLCITYLQYLGINASSCSITAFT
IERYIAICHPIKAQFLCTFSRAKKIIIFVWAFTSIYCMLWFFLLDLNISTYKDAIVISCG
YKISRNYYSPIYLMDFGVFYVMPMILATVLYGFIARILFLNPIPSDPKENSKTWKNDSTH
QNKNMNLNTTNRCFNSTVSSRKQVTKMLAVVVILFALLWMPYRTLVVVNSFLSSPFQENW
FLLFCRICIYLNSAINPVIYNLMSQKFRAAFRKLCNCKQKPTEKAANYSVALNYSVIKES
DRFSTELDDITVTDTYVSTTKVSFDDTCLASEKNGPSSCTYGYSLTAKQEKI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50173821
NameBDBM50173821
Synonyms:1-[3-[2-(tert-butyl)-1H-4-imidazolyl]-2-[5-oxo-(2S)-tetrahydro-1H-2-pyrrolylcarboxamido]-(2S)-propanoyl]-(2S)-tetrahydro-1H-2-pyrrolecarboxamide | CHEMBL382714
TypeSmall organic molecule
Emp. Form.C20H30N6O4
Mol. Mass.418.49
SMILESCC(C)(C)c1ncc(C[C@H](NC(=O)[C@@H]2CCC(=O)N2)C(=O)N2CCC[C@H]2C(N)=O)[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a