Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target11-beta-hydroxysteroid dehydrogenase 2
LigandBDBM50174285
Substrate/Competitorn/a
Meas. Tech.ChEMBL_326695
IC50 183±n/a nM
Citation Gu, XDragovic, JKoo, GCKoprak, SLLeGrand, CMundt, SSShah, KSpringer, MSTan, EYThieringer, RHermanowski-Vosatka, AZokian, HJBalkovec, JMWaddell, ST Discovery of 4-heteroarylbicyclo[2.2.2]octyltriazoles as potent and selective inhibitors of 11beta-HSD1: novel therapeutic agents for the treatment of metabolic syndrome. Bioorg Med Chem Lett15:5266-9 (2005) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
11-beta-hydroxysteroid dehydrogenase 2
Name:11-beta-hydroxysteroid dehydrogenase 2
Synonyms:11-DH2 | 11-beta-HSD2 | 11-beta-Hydroxysteroid Dehydrogenase 2 (11-beta-HSD2) | 11-beta-hydroxysteroid dehydrogenase type 2 | 11-beta-hydroxysteroid dehydrogenase type 2 (11-beta-HSD2) | Corticosteroid 11-beta-dehydrogenase isozyme 2 | NAD-dependent 11-beta-hydroxysteroid dehydrogenase
Type:Enzyme
Mol. Mass.:44141.72
Organism:Homo sapiens (Human)
Description:Purified recombinant human 11beta-HSD2.
Residue:405
Sequence:
MERWPWPSGGAWLLVAARALLQLLRSDLRLGRPLLAALALLAALDWLCQRLLPPPAALAV
LAAAGWIALSRLARPQRLPVATRAVLITGCDSGFGKETAKKLDSMGFTVLATVLELNSPG
AIELRTCCSPRLRLLQMDLTKPGDISRVLEFTKAHTTSTGLWGLVNNAGHNEVVADAELS
PVATFRSCMEVNFFGALELTKGLLPLLRSSRGRIVTVGSPAGDMPYPCLGAYGTSKAAVA
LLMDTFSCELLPWGVKVSIIQPGCFKTESVRNVGQWEKRKQLLLANLPQELLQAYGKDYI
EHLHGQFLHSLRLAMSDLTPVVDAITDALLAARPRRRYYPGQGLGLMYFIHYYLPEGLRR
RFLQAFFISHCLPRALQPGQPGTTPPQDAAQDPNLSPGPSPAVAR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50174285
NameBDBM50174285
Synonyms:3-(4-pentylbicyclo[2.2.2]octan-1-yl)-5,6,7,8,9,10-hexahydro-[1,2,4]triazolo[4,3-a]azocine | CHEMBL200513
TypeSmall organic molecule
Emp. Form.C21H35N3
Mol. Mass.329.5227
SMILESCCCCCC12CCC(CC1)(CC2)c1nnc2CCCCCCn12
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a