Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target1-deoxy-D-xylulose 5-phosphate reductoisomerase
LigandBDBM50153713
Substrate/Competitorn/a
Meas. Tech.ChEMBL_345851
IC50 30±n/a nM
Citation Haemers, TWiesner, JVan Poecke, SGoeman, JHenschker, DBeck, EJomaa, HVan Calenbergh, S Synthesis of alpha-substituted fosmidomycin analogues as highly potent Plasmodium falciparum growth inhibitors. Bioorg Med Chem Lett16:1888-91 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Name:1-deoxy-D-xylulose 5-phosphate reductoisomerase
Synonyms:1-Deoxy-D-xylulose 5-phosphate reductoisomerase (DXP) | 1-Deoxyxylulose 5-phosphate reductoisomerase (DXR) | 1-deoxy-D-xylulose 5-phosphate reductoisomerase (DXR) | 2-C-methyl-D-erythritol 4-phosphate synthase | DXP reductoisomerase
Type:Protein
Mol. Mass.:43384.52
Organism:Escherichia coli
Description:P45568
Residue:398
Sequence:
MKQLTILGSTGSIGCSTLDVVRHNPEHFRVVALVAGKNVTRMVEQCLEFSPRYAVMDDEA
SAKLLKTMLQQQGSRTEVLSGQQAACDMAALEDVDQVMAAIVGAAGLLPTLAAIRAGKTI
LLANKESLVTCGRLFMDAVKQSKAQLLPVDSEHNAIFQSLPQPIQHNLGYADLEQNGVVS
ILLTGSGGPFRETPLRDLATMTPDQACRHPNWSMGRKISVDSATMMNKGLEYIEARWLFN
ASASQMEVLIHPQSVIHSMVRYQDGSVLAQLGEPDMRTPIAHTMAWPNRVNSGVKPLDFC
KLSALTFAAPDYDRYPCLKLAMEAFEQGQAATTALNAANEITVAAFLAQQIRFTDIAALN
LSVLEKMDMREPQCVDDVLSVDANAREVARKEVMRLAS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50153713
NameBDBM50153713
Synonyms:3-(N-hydroxyformamido)propylphosphonic acid | 3-[FORMYL(HYDROXY)AMINO]PROPYLPHOSPHONIC ACID | CHEMBL203125 | [3-(Formyl-hydroxy-amino)-propyl]-phosphonic acid | fosmidomycin
TypeSmall organic molecule
Emp. Form.C4H10NO5P
Mol. Mass.183.0997
SMILESON(CCCP(O)(O)=O)C=O
Structure
n/a