Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetBcl-2-like protein 1
LigandBDBM50181867
Substrate/Competitorn/a
Meas. Tech.ChEMBL_332730
Ki 3850±n/a nM
Citation Wendt, MDShen, WKunzer, AMcClellan, WJBruncko, MOost, TKDing, HJoseph, MKZhang, HNimmer, PMNg, SCShoemaker, ARPetros, AMOleksijew, AMarsh, KBauch, JOltersdorf, TBelli, BAMartineau, DFesik, SWRosenberg, SHElmore, SW Discovery and structure-activity relationship of antagonists of B-cell lymphoma 2 family proteins with chemopotentiation activity in vitro and in vivo. J Med Chem49:1165-81 (2006) [PubMed]  Article
More Info.:Get all data from this article,  Assay Method
 
Bcl-2-like protein 1
Name:Bcl-2-like protein 1
Synonyms:Anti-apoptotic Bcl-2 protein | Apoptosis Regulator Bcl-xL | Apoptosis regulator Bcl-X | BCL2-like 1 isoform 1 | Bcl-2-like protein 1 (Bcl-XL) | Bcl-X | Bcl2-L-1 | Bcl2-antagonist of cell death (BAD)
Type:Mitochondrion membrane; Single-pass membrane protein
Mol. Mass.:26039.60
Organism:Homo sapiens (Human)
Description:n/a
Residue:233
Sequence:
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM50181867
NameBDBM50181867
Synonyms:4-((S)-3-dimethylamino-1-phenylsulfanylmethylpropylamino)--[4-(4,4-dimethylpiperidin-1-yl)benzoyl]-3-nitrobenzenesulfonamide | CHEMBL379895
TypeSmall organic molecule
Emp. Form.C32H41N5O5S2
Mol. Mass.639.828
SMILESCN(C)CC[C@@H](CSc1ccccc1)Nc1ccc(cc1[N+]([O-])=O)S(=O)(=O)NC(=O)c1ccc(cc1)N1CCC(C)(C)CC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least:
n/a